BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11g23r (721 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykin... 26 1.4 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 24 4.1 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 23 7.2 >AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykinin receptor protein. Length = 450 Score = 25.8 bits (54), Expect = 1.4 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = -2 Query: 369 MYSNINL*YTYIYVTKLHRPTQTLFCK 289 M S +N+ + Y Y+ L P T++CK Sbjct: 133 MVSTLNVTFNYTYMLYLDWPFGTMYCK 159 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 24.2 bits (50), Expect = 4.1 Identities = 14/52 (26%), Positives = 25/52 (48%), Gaps = 3/52 (5%) Frame = +2 Query: 332 YMYVYYKLILEYILIFVLIIMNTGLSTNFNNLK*NA---VDITLTMIDNRYY 478 YMY+Y+ + + F L + + NFN K A +++ +T +YY Sbjct: 1539 YMYLYFVFFIIFGSFFTLNLFIGVIIDNFNEQKKKAGGSLEMFMTEDQKKYY 1590 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.4 bits (48), Expect = 7.2 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +1 Query: 70 SQFRLLKCEWVCNKST 117 ++FR+ C W+CN ST Sbjct: 843 NRFRIF-CHWLCNHST 857 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 640,849 Number of Sequences: 2352 Number of extensions: 11938 Number of successful extensions: 56 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 56 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 56 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73181328 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -