BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11g22r (707 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles ... 23 7.1 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 23 9.4 >M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 1222 Score = 23.4 bits (48), Expect = 7.1 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +3 Query: 42 LKEPSXPNISSAVFGF 89 L+EPS P +S FGF Sbjct: 575 LEEPSSPRLSDRQFGF 590 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 23.0 bits (47), Expect = 9.4 Identities = 19/64 (29%), Positives = 34/64 (53%), Gaps = 2/64 (3%) Frame = -2 Query: 415 KIIMMEDDNAIVAGILSILDLDTVK-MGHFLQMTPMVMKKMVVA-SQLYVHNQNYEEMYK 242 +I+ + +IVAG L+ D V + F M ++ ++VA Q+Y +NQN E Y+ Sbjct: 530 RIVQCDQRISIVAGYLT----DEVSGLSPFTFMHRDDVRWVIVALRQMYDYNQNGESCYR 585 Query: 241 YIPK 230 + + Sbjct: 586 LMSR 589 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 721,225 Number of Sequences: 2352 Number of extensions: 14542 Number of successful extensions: 30 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 72340815 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -