BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11g22r (707 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z47811-2|CAA87786.2| 1307|Caenorhabditis elegans Hypothetical pr... 30 1.4 AF025453-10|AAK31402.3| 487|Caenorhabditis elegans Hypothetical... 29 3.3 Z32683-1|CAA83621.1| 812|Caenorhabditis elegans Hypothetical pr... 28 5.7 Z80220-6|CAB02305.1| 282|Caenorhabditis elegans Hypothetical pr... 27 9.9 Z30973-4|CAA83220.3| 431|Caenorhabditis elegans Hypothetical pr... 27 9.9 >Z47811-2|CAA87786.2| 1307|Caenorhabditis elegans Hypothetical protein K02C4.3 protein. Length = 1307 Score = 30.3 bits (65), Expect = 1.4 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -2 Query: 172 YWRKKVKEYSDWLEEDDQYGTDESKRPGKPKTAEDMFG 59 YW K+K+ D LEE ++ + R PK D FG Sbjct: 739 YWTYKLKKSIDGLEEWEKLNDQNADRVDWPKVESDSFG 776 >AF025453-10|AAK31402.3| 487|Caenorhabditis elegans Hypothetical protein C08F1.1 protein. Length = 487 Score = 29.1 bits (62), Expect = 3.3 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = +3 Query: 549 LNISSNNGLLGFILNNSGAVVRTE*YKSNFSFVLSKLYLHPRR 677 ++I +NNG +LN ++ E + S+ LS +Y H R Sbjct: 308 ISIKNNNGFASLMLNCENELIEKERWAIQASYQLSLVYCHGNR 350 >Z32683-1|CAA83621.1| 812|Caenorhabditis elegans Hypothetical protein R07E5.1 protein. Length = 812 Score = 28.3 bits (60), Expect = 5.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -2 Query: 166 RKKVKEYSDWLEEDDQYGTDESKRP 92 RKK+ Y E+DD+ G+ SK+P Sbjct: 3 RKKLAAYGQEFEDDDEEGSSVSKKP 27 >Z80220-6|CAB02305.1| 282|Caenorhabditis elegans Hypothetical protein T08G11.2 protein. Length = 282 Score = 27.5 bits (58), Expect = 9.9 Identities = 14/47 (29%), Positives = 25/47 (53%) Frame = -2 Query: 649 RTKEKLDLYYSVRTTAPELFSIKPSNPLFDEILSLGAILILPKTATS 509 RT K + +YS+RTT + F + P + SL +++ KT+ + Sbjct: 218 RTTTKKNRHYSIRTTCDQQFFVDCGYPNVRKHYSLSHLVMFYKTSAT 264 >Z30973-4|CAA83220.3| 431|Caenorhabditis elegans Hypothetical protein B0284.1 protein. Length = 431 Score = 27.5 bits (58), Expect = 9.9 Identities = 14/24 (58%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = -2 Query: 676 LRGCKYSLERTKEKL-DLYYSVRT 608 + CK SL R KEKL +L YS RT Sbjct: 277 INSCKTSLRRIKEKLNNLKYSART 300 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,141,752 Number of Sequences: 27780 Number of extensions: 341343 Number of successful extensions: 1041 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 996 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1041 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1645110168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -