BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11g21r (713 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37698| Best HMM Match : Ribosomal_S3Ae (HMM E-Value=5e-21) 174 7e-44 SB_45038| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_21643| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_37029| Best HMM Match : 7tm_1 (HMM E-Value=4.2039e-45) 29 3.7 SB_50701| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 >SB_37698| Best HMM Match : Ribosomal_S3Ae (HMM E-Value=5e-21) Length = 147 Score = 174 bits (423), Expect = 7e-44 Identities = 79/114 (69%), Positives = 98/114 (85%) Frame = -3 Query: 402 TLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCYAQHTQVRAIRKKMCEIITRDVTN 223 TLIEA +DVKTTDGY+LR+FCIGFT + +KT YA+HTQ++AIRKKM +IITR+V+ Sbjct: 2 TLIEAAVDVKTTDGYLLRMFCIGFTKRRQNQIKKTAYAKHTQIKAIRKKMVDIITREVST 61 Query: 222 SELREVVNKLIPDSIAKDIEKACHGIYPLRDVCIRKVKVLKRPRFEISKLMELH 61 ++L+EVVNKLIPDSI KDIEK+C IYPL DV IRKVKVLK+P+F+I KLME+H Sbjct: 62 NDLKEVVNKLIPDSIGKDIEKSCQSIYPLHDVHIRKVKVLKKPKFDIGKLMEMH 115 >SB_45038| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 561 Score = 29.5 bits (63), Expect = 2.8 Identities = 16/60 (26%), Positives = 26/60 (43%) Frame = +2 Query: 509 LRKDLSASVSACRSARETSKTLPFNPSEAIFVPWVRLTSVVPTCLLLNIDGALTSYQSLR 688 LRK L S + RE + L FNP E+ +V L + ++ + +SL+ Sbjct: 302 LRKQLIDMASVAKDLREIDELLKFNPDESAYVLQAESLKKANNVLQIELEELIKKEKSLK 361 >SB_21643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1974 Score = 29.5 bits (63), Expect = 2.8 Identities = 11/30 (36%), Positives = 21/30 (70%) Frame = -3 Query: 570 VFEVSLADLQADTDAERSFRKFRLIAEYVQ 481 +F + +D+QA+++ FR+F L+ EYV+ Sbjct: 1176 IFNNTFSDVQANSNQIWKFRRFELVMEYVE 1205 >SB_37029| Best HMM Match : 7tm_1 (HMM E-Value=4.2039e-45) Length = 1102 Score = 29.1 bits (62), Expect = 3.7 Identities = 15/57 (26%), Positives = 32/57 (56%), Gaps = 2/57 (3%) Frame = +2 Query: 383 MLASMRVCHFLTIHLSLSVVRSMPWKLQSTLRPCTYSAINLNLRKDLSA--SVSACR 547 ++ SM +C ++ + +SL R + + +L PC Y ++++L + + S+S CR Sbjct: 948 VVMSMSLCRYVHVVMSLCPCRYVHVVMSMSLCPCRYVVMSMSLCRYIHVVMSMSLCR 1004 >SB_50701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 311 Score = 28.7 bits (61), Expect = 4.9 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 705 IVDPFTRKDWYDVKAPSMFSKRQ 637 +V+P+ KDW D SMFS RQ Sbjct: 98 LVEPWRWKDWEDFTQSSMFSGRQ 120 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,039,140 Number of Sequences: 59808 Number of extensions: 500965 Number of successful extensions: 1533 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1405 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1531 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1889780269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -