BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11g19r (429 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855493-1|ABH88180.1| 127|Tribolium castaneum chemosensory pro... 21 6.6 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 20 8.7 AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 20 8.7 AF231104-1|AAF64149.1| 142|Tribolium castaneum labial protein p... 20 8.7 AF231103-1|AAF64148.1| 142|Tribolium castaneum labial protein p... 20 8.7 >DQ855493-1|ABH88180.1| 127|Tribolium castaneum chemosensory protein 7 protein. Length = 127 Score = 20.6 bits (41), Expect = 6.6 Identities = 7/15 (46%), Positives = 12/15 (80%) Frame = +1 Query: 340 DDRGQYEQKSELHLA 384 D +GQY+++ E H+A Sbjct: 108 DPQGQYKKRYEEHVA 122 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 20.2 bits (40), Expect = 8.7 Identities = 6/12 (50%), Positives = 8/12 (66%) Frame = -2 Query: 146 GKWERHSSRLSA 111 G WERH+ + A Sbjct: 153 GNWERHTKGIGA 164 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 20.2 bits (40), Expect = 8.7 Identities = 14/45 (31%), Positives = 18/45 (40%) Frame = +2 Query: 233 TEKLRNSLSFEAXVPMLKTRALLVELGSATSLVDTATTAVNTNKR 367 T K L E TRA +E+ SA L +T N+R Sbjct: 261 TNKQLTELEKEFHFNKYLTRARRIEIASALQLNETQVKIWFQNRR 305 >AF231104-1|AAF64149.1| 142|Tribolium castaneum labial protein protein. Length = 142 Score = 20.2 bits (40), Expect = 8.7 Identities = 14/45 (31%), Positives = 18/45 (40%) Frame = +2 Query: 233 TEKLRNSLSFEAXVPMLKTRALLVELGSATSLVDTATTAVNTNKR 367 T K L E TRA +E+ SA L +T N+R Sbjct: 50 TNKQLTELEKEFHFNKYLTRARRIEIASALQLNETQVKIWFQNRR 94 >AF231103-1|AAF64148.1| 142|Tribolium castaneum labial protein protein. Length = 142 Score = 20.2 bits (40), Expect = 8.7 Identities = 14/45 (31%), Positives = 18/45 (40%) Frame = +2 Query: 233 TEKLRNSLSFEAXVPMLKTRALLVELGSATSLVDTATTAVNTNKR 367 T K L E TRA +E+ SA L +T N+R Sbjct: 50 TNKQLTELEKEFHFNKYLTRARRIEIASALQLNETQVKIWFQNRR 94 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 88,319 Number of Sequences: 336 Number of extensions: 1682 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 9460170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -