BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11g13f (601 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL132876-38|CAD21663.2| 224|Caenorhabditis elegans Hypothetical... 29 2.5 AC024776-3|AAK68466.1| 453|Caenorhabditis elegans Hypothetical ... 28 4.4 Z74031-3|CAA98455.1| 245|Caenorhabditis elegans Hypothetical pr... 28 5.9 Z92838-7|CAB07405.1| 593|Caenorhabditis elegans Hypothetical pr... 27 7.7 Z69361-3|CAA93289.1| 533|Caenorhabditis elegans Hypothetical pr... 27 7.7 Z68882-20|CAA93112.1| 533|Caenorhabditis elegans Hypothetical p... 27 7.7 AF286205-1|AAK28740.1| 593|Caenorhabditis elegans C kinase adap... 27 7.7 >AL132876-38|CAD21663.2| 224|Caenorhabditis elegans Hypothetical protein Y105E8A.14 protein. Length = 224 Score = 29.1 bits (62), Expect = 2.5 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Frame = +2 Query: 347 PLVQIIVNVNQPGADAAIIPQPVIVDESD--EVKPD 448 PL + + ++ PG +A P PV+ E D +VKPD Sbjct: 75 PLQAVDLKMDIPGTPSAAAPDPVVKQEVDDEDVKPD 110 >AC024776-3|AAK68466.1| 453|Caenorhabditis elegans Hypothetical protein Y41D4B.16 protein. Length = 453 Score = 28.3 bits (60), Expect = 4.4 Identities = 10/29 (34%), Positives = 20/29 (68%) Frame = -1 Query: 127 LQLSISLSGFDGASGSHSYDSNESNEEFH 41 + L++ LSG GA+ S++ ++ N++FH Sbjct: 304 VNLTVQLSGQSGATDSYTTSGSQVNDDFH 332 >Z74031-3|CAA98455.1| 245|Caenorhabditis elegans Hypothetical protein F32D8.3 protein. Length = 245 Score = 27.9 bits (59), Expect = 5.9 Identities = 10/27 (37%), Positives = 11/27 (40%) Frame = +1 Query: 7 FDHCKQTKVSKNEIPRCFRCYRSCGCR 87 F HC N P C +C C CR Sbjct: 69 FSHCACESTCNNPDPYCSKCEPGCTCR 95 >Z92838-7|CAB07405.1| 593|Caenorhabditis elegans Hypothetical protein T03D8.1a protein. Length = 593 Score = 27.5 bits (58), Expect = 7.7 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +2 Query: 362 IVNVNQPGADAAIIPQPVIVDES 430 +V+ QP DAAI+P P+ D+S Sbjct: 30 LVSEQQPSFDAAIVPMPIPNDKS 52 >Z69361-3|CAA93289.1| 533|Caenorhabditis elegans Hypothetical protein T13H10.1 protein. Length = 533 Score = 27.5 bits (58), Expect = 7.7 Identities = 13/34 (38%), Positives = 22/34 (64%), Gaps = 3/34 (8%) Frame = -1 Query: 163 VCAGAVD---SVQNGLQLSISLSGFDGASGSHSY 71 +CAGA + ++ ++ ++L GFD A GS+SY Sbjct: 358 ICAGAEEERVTMSEAVRELLTLEGFDQAPGSNSY 391 >Z68882-20|CAA93112.1| 533|Caenorhabditis elegans Hypothetical protein T13H10.1 protein. Length = 533 Score = 27.5 bits (58), Expect = 7.7 Identities = 13/34 (38%), Positives = 22/34 (64%), Gaps = 3/34 (8%) Frame = -1 Query: 163 VCAGAVD---SVQNGLQLSISLSGFDGASGSHSY 71 +CAGA + ++ ++ ++L GFD A GS+SY Sbjct: 358 ICAGAEEERVTMSEAVRELLTLEGFDQAPGSNSY 391 >AF286205-1|AAK28740.1| 593|Caenorhabditis elegans C kinase adapter 1 protein. Length = 593 Score = 27.5 bits (58), Expect = 7.7 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +2 Query: 362 IVNVNQPGADAAIIPQPVIVDES 430 +V+ QP DAAI+P P+ D+S Sbjct: 30 LVSEQQPSFDAAIVPMPIPNDKS 52 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,779,424 Number of Sequences: 27780 Number of extensions: 179055 Number of successful extensions: 480 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 456 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 480 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1279376318 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -