BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11g13f (601 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g66230.1 68418.m08343 expressed protein 32 0.33 At5g19130.2 68418.m02277 GPI transamidase component family prote... 29 3.1 At5g19130.1 68418.m02276 GPI transamidase component family prote... 29 3.1 At1g66230.1 68414.m07517 myb family transcription factor (MYB20)... 28 5.4 At2g39810.1 68415.m04890 expressed protein 27 7.2 At3g05360.1 68416.m00584 disease resistance family protein / LRR... 27 9.5 At2g27060.1 68415.m03251 leucine-rich repeat transmembrane prote... 27 9.5 At1g68510.1 68414.m07826 LOB domain protein 42 / lateral organ b... 27 9.5 >At5g66230.1 68418.m08343 expressed protein Length = 329 Score = 31.9 bits (69), Expect = 0.33 Identities = 22/79 (27%), Positives = 32/79 (40%) Frame = -1 Query: 295 WLSDSTTVGKREVDDFGSEDRLLYGVESDEDFVQMLEKESSGGWVCAGAVDSVQNGLQLS 116 W + K E D E+ YG E DE++ E+E G G VD + G++ Sbjct: 223 WSMQANASAKDEEYDDEEEEAYSYGEEYDEEYYDEEEEEEEG-----GIVDGLCEGIRKM 277 Query: 115 ISLSGFDGASGSHSYDSNE 59 + F G YDS + Sbjct: 278 SVETDFAGKHTRFVYDSED 296 >At5g19130.2 68418.m02277 GPI transamidase component family protein / Gaa1-like family protein contains Pfam profile: PF04114 Gaa1-like, GPI transamidase component Length = 696 Score = 28.7 bits (61), Expect = 3.1 Identities = 17/55 (30%), Positives = 25/55 (45%) Frame = -1 Query: 481 AFFSLFGDNNGVGFDFIRLVNNDGLGNDSCISAWLVHVHNDLNERSGLAWCDWSN 317 + FSL + D I LV + G+ ++AWL H+ + S L CD N Sbjct: 197 SLFSLLSRVTWLSKDIIWLVADSRYGDYRPVAAWLTEYHSPSFKVSDLLKCDEQN 251 >At5g19130.1 68418.m02276 GPI transamidase component family protein / Gaa1-like family protein contains Pfam profile: PF04114 Gaa1-like, GPI transamidase component Length = 699 Score = 28.7 bits (61), Expect = 3.1 Identities = 17/55 (30%), Positives = 25/55 (45%) Frame = -1 Query: 481 AFFSLFGDNNGVGFDFIRLVNNDGLGNDSCISAWLVHVHNDLNERSGLAWCDWSN 317 + FSL + D I LV + G+ ++AWL H+ + S L CD N Sbjct: 200 SLFSLLSRVTWLSKDIIWLVADSRYGDYRPVAAWLTEYHSPSFKVSDLLKCDEQN 254 >At1g66230.1 68414.m07517 myb family transcription factor (MYB20) similar to myb-related transcription factor GI:1430846 from [Lycopersicon esculentum]; contains PFAM profile: Myb DNA binding domain PF00249 Length = 282 Score = 27.9 bits (59), Expect = 5.4 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 3/48 (6%) Frame = -1 Query: 334 WCDW---SNDNRGGHDWLSDSTTVGKREVDDFGSEDRLLYGVESDEDF 200 W D+ +NDN G D + ++ + E+ DF S D LL ES F Sbjct: 233 WSDYGNSNNDNNNGVDNIIENNMMSLWEISDFSSLD-LLLNDESSSTF 279 >At2g39810.1 68415.m04890 expressed protein Length = 865 Score = 27.5 bits (58), Expect = 7.2 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -1 Query: 322 SNDNRGGHDWLSDSTTVGKREVDDFGS 242 S +N GG W SD T+ + E+ FGS Sbjct: 825 SRNNSGGLRWRSDETSDDEDELTSFGS 851 >At3g05360.1 68416.m00584 disease resistance family protein / LRR family protein contains leucine rich-repeat domains Pfam:PF00560, INTERPRO:IPR001611; similar to elicitor-inducible LRR receptor-like protein EILP [Nicotiana tabacum] gi|6635236|dbj|BAA88636; similar to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 786 Score = 27.1 bits (57), Expect = 9.5 Identities = 26/90 (28%), Positives = 40/90 (44%), Gaps = 7/90 (7%) Frame = -1 Query: 496 LRDNGAFFSLFGDNNGVGFDFIRLVNNDGLGNDSCISA-----WLVHVHNDLNER-SGLA 335 LR N + SL+ D+ GF +RL++ G +S W V + L E S + Sbjct: 504 LRSNAFYGSLYYDHISFGFQHLRLIDISQNGFSGTLSPLYFSNWREMVTSVLEENGSNIG 563 Query: 334 WCDWSNDNRGGHDWLSDSTTVGKREVD-DF 248 DW +G S+S T+ + V+ DF Sbjct: 564 TEDWYMGEKGPEFSHSNSMTMIYKGVETDF 593 >At2g27060.1 68415.m03251 leucine-rich repeat transmembrane protein kinase, putative Length = 1007 Score = 27.1 bits (57), Expect = 9.5 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = -1 Query: 322 SNDNRGGHDWLSDSTTVGKREVDDFGSEDRLLYGVESDE 206 SN+N G L D++TVG + + G L GV S+E Sbjct: 425 SNNNFSGSLPLQDASTVGNLSLTNIGLSHNSLGGVLSEE 463 >At1g68510.1 68414.m07826 LOB domain protein 42 / lateral organ boundaries domain protein 42 (LBD42) identical to LOB DOMAIN 42 [Arabidopsis thaliana] GI:17227174; supported by full-length cDNA gi:17227173. Length = 233 Score = 27.1 bits (57), Expect = 9.5 Identities = 16/34 (47%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -1 Query: 175 SGGWV-CAGAVDSVQNGLQLSISLSGFDGASGSH 77 SG W C AVD+V NG L I+ + AS SH Sbjct: 90 SGNWAQCQAAVDAVLNG--LPITHTPLPSASASH 121 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,458,378 Number of Sequences: 28952 Number of extensions: 172566 Number of successful extensions: 466 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 461 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 466 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1187288784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -