BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11g11f (510 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR ... 26 0.85 CR954257-5|CAJ14156.1| 227|Anopheles gambiae predicted protein ... 23 4.5 AJ618923-1|CAF02002.1| 155|Anopheles gambiae odorant-binding pr... 23 4.5 AJ420785-4|CAD12784.1| 395|Anopheles gambiae serpin protein. 23 6.0 M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles ... 23 7.9 >AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR protein. Length = 640 Score = 25.8 bits (54), Expect = 0.85 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = -1 Query: 363 QSGVIFVLHYIDFLAAQVCCQTHTKSVRTRHTSFRV 256 +SG I VLH + L CC HT R+ V Sbjct: 575 RSGFILVLHGVPGLQQLCCCIRHTPPAIARNVGSSV 610 >CR954257-5|CAJ14156.1| 227|Anopheles gambiae predicted protein protein. Length = 227 Score = 23.4 bits (48), Expect = 4.5 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 142 PVRLVLCTRSVCSHLNAKP 86 P +V CTR+VC+ N P Sbjct: 117 PSMIVKCTRNVCTGRNEVP 135 >AJ618923-1|CAF02002.1| 155|Anopheles gambiae odorant-binding protein OBPjj5c protein. Length = 155 Score = 23.4 bits (48), Expect = 4.5 Identities = 13/52 (25%), Positives = 22/52 (42%) Frame = -2 Query: 503 IASSSAFTVWFRPSFHSFSVASTSLSNQAANFGPNFT*ATYTMTSSDSPE*Y 348 +AS + + SF+ VA +S Q F T+++ D P+ Y Sbjct: 76 VASKKCYIITVGDSFYLRDVAKNLISPQCIPSSFRFLQCTFSIVYRDCPDIY 127 >AJ420785-4|CAD12784.1| 395|Anopheles gambiae serpin protein. Length = 395 Score = 23.0 bits (47), Expect = 6.0 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +1 Query: 88 ALRSGASKQTACTALVARGSASDVA 162 AL G+S+QTA + + SDVA Sbjct: 363 ALMMGSSRQTAFVGRLVKPDQSDVA 387 >M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 1222 Score = 22.6 bits (46), Expect = 7.9 Identities = 9/13 (69%), Positives = 12/13 (92%) Frame = -2 Query: 110 LLAPERKATRDNI 72 LLAP+R ATR++I Sbjct: 913 LLAPDRAATREDI 925 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 607,335 Number of Sequences: 2352 Number of extensions: 12937 Number of successful extensions: 20 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46091631 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -