BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11g11f (510 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 23 2.4 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 23 2.4 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 21 5.6 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 21 7.4 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 21 7.4 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 21 7.4 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 21 7.4 DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 21 7.4 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 21 7.4 DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 21 7.4 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 21 7.4 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 21 7.4 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 21 9.8 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 9.8 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 22.6 bits (46), Expect = 2.4 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -3 Query: 505 RLRPPVLSRFGS 470 RLRPP+ RFGS Sbjct: 175 RLRPPLNPRFGS 186 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 22.6 bits (46), Expect = 2.4 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -3 Query: 505 RLRPPVLSRFGS 470 RLRPP+ RFGS Sbjct: 175 RLRPPLNPRFGS 186 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.4 bits (43), Expect = 5.6 Identities = 6/15 (40%), Positives = 9/15 (60%) Frame = +2 Query: 383 MWLT*NSDQNWLLGW 427 +W + DQ W+L W Sbjct: 595 LWYVPSLDQVWILNW 609 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.0 bits (42), Expect = 7.4 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -3 Query: 505 RLRPPVLSRFG 473 RLRPP+ RFG Sbjct: 160 RLRPPLNPRFG 170 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.0 bits (42), Expect = 7.4 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -3 Query: 505 RLRPPVLSRFG 473 RLRPP+ RFG Sbjct: 160 RLRPPLNPRFG 170 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.0 bits (42), Expect = 7.4 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -3 Query: 505 RLRPPVLSRFG 473 RLRPP+ RFG Sbjct: 160 RLRPPLNPRFG 170 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.0 bits (42), Expect = 7.4 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -3 Query: 505 RLRPPVLSRFG 473 RLRPP+ RFG Sbjct: 160 RLRPPLNPRFG 170 >DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.0 bits (42), Expect = 7.4 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -3 Query: 505 RLRPPVLSRFG 473 RLRPP+ RFG Sbjct: 160 RLRPPLNPRFG 170 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.0 bits (42), Expect = 7.4 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -3 Query: 505 RLRPPVLSRFG 473 RLRPP+ RFG Sbjct: 160 RLRPPLNPRFG 170 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.0 bits (42), Expect = 7.4 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -3 Query: 505 RLRPPVLSRFG 473 RLRPP+ RFG Sbjct: 172 RLRPPLNPRFG 182 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.0 bits (42), Expect = 7.4 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -3 Query: 505 RLRPPVLSRFG 473 RLRPP+ RFG Sbjct: 172 RLRPPLNPRFG 182 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 21.0 bits (42), Expect = 7.4 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -3 Query: 505 RLRPPVLSRFG 473 RLRPP+ RFG Sbjct: 400 RLRPPLNPRFG 410 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 20.6 bits (41), Expect = 9.8 Identities = 13/50 (26%), Positives = 20/50 (40%) Frame = +1 Query: 238 EWFQFFHSKTGVTGPYTFGVGLATYLCSKEIYVMEHEYYSGLSLLVMVYV 387 EW S + T FG+G T L S I + H + + + + V Sbjct: 207 EWEIVHMSHSESTIDSKFGLGFTTDLLSYNILLRRHYSMNSTTYVTLTIV 256 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 20.6 bits (41), Expect = 9.8 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -3 Query: 499 RPPVLSRFGSDLRSIRS 449 +PPV + +GSD I S Sbjct: 558 KPPVATMYGSDEEIINS 574 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,308 Number of Sequences: 438 Number of extensions: 3577 Number of successful extensions: 14 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14109465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -