BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11g10r (674 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48378| Best HMM Match : Ribosomal_S6e (HMM E-Value=0) 281 3e-76 SB_47786| Best HMM Match : Ank (HMM E-Value=4.4e-30) 37 0.013 SB_59495| Best HMM Match : RnaseH (HMM E-Value=0.0011) 30 2.0 SB_53135| Best HMM Match : RnaseH (HMM E-Value=0.0016) 30 2.0 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 29 3.4 SB_7395| Best HMM Match : SURF6 (HMM E-Value=1.8) 29 4.5 SB_54650| Best HMM Match : IncA (HMM E-Value=0.84) 29 4.5 SB_56618| Best HMM Match : DUF1213 (HMM E-Value=0.022) 28 6.0 SB_41444| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_29770| Best HMM Match : ig (HMM E-Value=3.4e-05) 28 7.9 SB_27725| Best HMM Match : RVT_1 (HMM E-Value=1.9e-19) 28 7.9 SB_5302| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_4034| Best HMM Match : Exo_endo_phos (HMM E-Value=9.7e-06) 28 7.9 SB_2184| Best HMM Match : AMP-binding (HMM E-Value=8.5e-06) 28 7.9 SB_32833| Best HMM Match : RVT_1 (HMM E-Value=2) 28 7.9 SB_5647| Best HMM Match : ResIII (HMM E-Value=1.1) 28 7.9 >SB_48378| Best HMM Match : Ribosomal_S6e (HMM E-Value=0) Length = 212 Score = 281 bits (690), Expect = 3e-76 Identities = 135/198 (68%), Positives = 156/198 (78%) Frame = -3 Query: 657 EVEADQLGDEWKGYVLRVAGGNDKQGFPMKQGVLTNSRVRLLMSKGHSCYRPRRDGERKR 478 EV + LGDEWKGYV R+ GGNDKQGFPMKQG++TN RVRLL+SKGHSCYRPRR GERKR Sbjct: 2 EVSGECLGDEWKGYVFRITGGNDKQGFPMKQGIMTNGRVRLLLSKGHSCYRPRRTGERKR 61 Query: 477 KSVRGCIVDANLSVLALVIVRKGAQEIPGLTDGNVPRRLGPKRASKIRKLFNLSKEDDVR 298 KSVRGCIVD+ LSVL+LVIV+KG Q+IPGLTD +PRRLGPKR KIRK+FNLSKEDDVR Sbjct: 62 KSVRGCIVDSQLSVLSLVIVKKGEQDIPGLTDNTIPRRLGPKRVGKIRKMFNLSKEDDVR 121 Query: 297 RYVVKRVLPAKEGKENAKPRHKAPKIQRLVTPVVLQXXXXXXXXXXXXXXXXKSSEAEYA 118 +YV++R LP KEGK K + KAPKIQRLVTPVVLQ K A+YA Sbjct: 122 QYVIRRPLPEKEGK---KAKSKAPKIQRLVTPVVLQRKRKRLALKRQRAQKCKQEAADYA 178 Query: 117 KLLAQRKKESKVRRQEEI 64 KLLA+R KE+K +R E++ Sbjct: 179 KLLAKRAKEAKEKRHEQL 196 >SB_47786| Best HMM Match : Ank (HMM E-Value=4.4e-30) Length = 796 Score = 37.1 bits (82), Expect = 0.013 Identities = 18/52 (34%), Positives = 27/52 (51%) Frame = +1 Query: 517 VAL*HQKTNTAVCQDALFHRESLLVVAASDTKYIALPFIA*LISLYFGAHAL 672 V L Q+ + A+ D L H +SL V+ SD + ++LP I + Y H L Sbjct: 252 VTLGEQEADAAIGHDPLLHGKSLFVITTSDPEDVSLPLIPQALPRYLHGHTL 303 >SB_59495| Best HMM Match : RnaseH (HMM E-Value=0.0011) Length = 515 Score = 29.9 bits (64), Expect = 2.0 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -1 Query: 302 YVVMSSNACSQPRKEKKMLNPDIRHLRSRG 213 Y V + C+ PR K+L P + HLR +G Sbjct: 50 YSVFPNGLCTCPRNFTKLLKPPLSHLRLKG 79 >SB_53135| Best HMM Match : RnaseH (HMM E-Value=0.0016) Length = 515 Score = 29.9 bits (64), Expect = 2.0 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -1 Query: 302 YVVMSSNACSQPRKEKKMLNPDIRHLRSRG 213 Y V + C+ PR K+L P + HLR +G Sbjct: 50 YSVFPNGLCTCPRNFTKLLKPPLSHLRLKG 79 >SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) Length = 172 Score = 29.1 bits (62), Expect = 3.4 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = -3 Query: 471 VRGCIVDANLSVLALVIVRKGAQEIPGLTDGNVPRRLGPKRASKIRK 331 VR C +D +VLA + + A E GLT+G V GP R +++ Sbjct: 86 VRSCPMDKQSTVLA--VETREACESKGLTEGCVSSAFGPGREEPVQE 130 >SB_7395| Best HMM Match : SURF6 (HMM E-Value=1.8) Length = 1365 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/30 (43%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Frame = -3 Query: 651 EADQLGDEWKGYVL--RVAGGNDKQGFPMK 568 E D+ G EW+G+V G D QG+ MK Sbjct: 815 EEDRTGQEWEGHVCDKEPEGKRDNQGYKMK 844 >SB_54650| Best HMM Match : IncA (HMM E-Value=0.84) Length = 291 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -3 Query: 381 GNVPRRLGPKRASKIRKLFNLSKEDDVRRYVVK 283 G+ + GP + SKI K+ ++DDV+ VVK Sbjct: 221 GSEAAKTGPNKLSKIDKVILAVEDDDVQEIVVK 253 >SB_56618| Best HMM Match : DUF1213 (HMM E-Value=0.022) Length = 1421 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/26 (42%), Positives = 20/26 (76%) Frame = -3 Query: 138 SSEAEYAKLLAQRKKESKVRRQEEIK 61 ++EAE +L Q+K+E K +R+EE++ Sbjct: 1173 AAEAERRRLEVQKKREEKKKREEEMR 1198 >SB_41444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 28.3 bits (60), Expect = 6.0 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = -3 Query: 333 KLFNLSKEDDVRRYVVKRVLPAKEGKENAKPRHKAPKIQR 214 + F+++KEDD+ Y++ L + K NA ++ P+ R Sbjct: 137 RAFDVTKEDDITMYIIITPLFMRARKNNAMEYNQKPRDPR 176 >SB_29770| Best HMM Match : ig (HMM E-Value=3.4e-05) Length = 454 Score = 27.9 bits (59), Expect = 7.9 Identities = 13/32 (40%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = +1 Query: 160 LLQSETMTS-TLQNYRGD*PLDLRCLMSGFSI 252 L+QSE+ T T NY P++L C GF + Sbjct: 329 LIQSESTTQVTWSNYADRDPIELNCTFDGFPV 360 >SB_27725| Best HMM Match : RVT_1 (HMM E-Value=1.9e-19) Length = 262 Score = 27.9 bits (59), Expect = 7.9 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +1 Query: 232 LMSGFSIFFSFLGWEHAFDDITTYIIFFA 318 L G S+FF+F+ E AFD + II++A Sbjct: 91 LAKGKSLFFAFVDLEKAFDRVPRDIIWWA 119 >SB_5302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 949 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +1 Query: 232 LMSGFSIFFSFLGWEHAFDDITTYIIFFA 318 L G S+FF+F+ E AFD + I+++A Sbjct: 628 LAKGKSLFFAFVDLEKAFDRVPRVILWWA 656 >SB_4034| Best HMM Match : Exo_endo_phos (HMM E-Value=9.7e-06) Length = 609 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +1 Query: 232 LMSGFSIFFSFLGWEHAFDDITTYIIFFA 318 L G S+FF+F+ E AFD + I+++A Sbjct: 545 LAKGKSLFFAFVDLEKAFDRVPRVILWWA 573 >SB_2184| Best HMM Match : AMP-binding (HMM E-Value=8.5e-06) Length = 757 Score = 27.9 bits (59), Expect = 7.9 Identities = 20/70 (28%), Positives = 35/70 (50%), Gaps = 7/70 (10%) Frame = -3 Query: 414 KGAQEIPGLTDGNV----PRRLGPK---RASKIRKLFNLSKEDDVRRYVVKRVLPAKEGK 256 +GA+++P L +G V P + G K R++ +++L E DVR + RV ++ Sbjct: 267 RGARDVPPLEEGGVVRMRPFKFGKKHWDRSTVVKRLGEYEVETDVRTHRRHRVGLKEQNL 326 Query: 255 ENAKPRHKAP 226 A P+ P Sbjct: 327 PPATPQEADP 336 >SB_32833| Best HMM Match : RVT_1 (HMM E-Value=2) Length = 317 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +1 Query: 232 LMSGFSIFFSFLGWEHAFDDITTYIIFFA 318 L G S+FF+F+ E AFD + I+++A Sbjct: 196 LAKGKSLFFAFVDLEKAFDRVPRVILWWA 224 >SB_5647| Best HMM Match : ResIII (HMM E-Value=1.1) Length = 1101 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/37 (29%), Positives = 22/37 (59%) Frame = -3 Query: 348 ASKIRKLFNLSKEDDVRRYVVKRVLPAKEGKENAKPR 238 A ++ + + DDV+ ++K ++P KEG E+ P+ Sbjct: 22 AGLVQNILDEDIPDDVKHRLLKPLVPEKEGPESLDPK 58 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,704,763 Number of Sequences: 59808 Number of extensions: 425443 Number of successful extensions: 1299 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 1177 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1296 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1733301648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -