BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11g10r (674 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 27 0.22 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 27 0.22 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 22 6.1 AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 22 6.1 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 26.6 bits (56), Expect = 0.22 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 Query: 515 EWPFDIRRRTRLFVRTPCFI 574 EWP +R+R LF+ CF+ Sbjct: 406 EWPRLLRKRKELFIAIVCFV 425 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 26.6 bits (56), Expect = 0.22 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 Query: 515 EWPFDIRRRTRLFVRTPCFI 574 EWP +R+R LF+ CF+ Sbjct: 459 EWPRLLRKRKELFIAIVCFV 478 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 21.8 bits (44), Expect = 6.1 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = -3 Query: 669 RMGAEVEADQLGDEWKGYV 613 R+G +++D L + +GYV Sbjct: 227 RIGLRIQSDSLAENVEGYV 245 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 21.8 bits (44), Expect = 6.1 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = -1 Query: 122 MLNCLHRERRNPRCVARKRSNAGGQLQCVI 33 +L + +RNP V RK+S+ +L+ ++ Sbjct: 112 LLGIVDDYQRNPSVVGRKKSSGWRKLRNIV 141 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,285 Number of Sequences: 438 Number of extensions: 3684 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20464920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -