BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11g10f (555 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 27 0.41 AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 26 0.72 DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. 25 1.3 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 25 2.2 AF063021-3|AAC16247.1| 484|Anopheles gambiae dopa decarboxylase... 25 2.2 AF063021-2|AAC16249.1| 515|Anopheles gambiae dopa decarboxylase... 25 2.2 AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical prote... 24 2.9 AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical prote... 24 2.9 AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 24 3.9 AJ618918-1|CAF01997.1| 228|Anopheles gambiae putative odorant-b... 24 3.9 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 24 3.9 AM042695-1|CAJ14970.1| 396|Anopheles gambiae 3-hydroxykynurenin... 23 6.7 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 27.1 bits (57), Expect = 0.41 Identities = 31/126 (24%), Positives = 52/126 (41%), Gaps = 5/126 (3%) Frame = -2 Query: 449 LDGGVHFHQSIQEFPGHPCAQ*QEPRPRDWRQQYIHELIYVFSLHRGAVCNMSGPLTSED 270 +DGG++ S++ FPG+ + + + + ++F LH V N L ED Sbjct: 167 VDGGLNIPHSVKRFPGYSAEN------KSFNAEMHRD--HIFGLH---VANYMRTLEEED 215 Query: 269 EHGCLS--GRPVSSGILACRCRQRHEVHSPSIHRLTD---QPLLRRPCAFRKRYEACARP 105 E + +S GI A ++ SI ++ P R P + R+ +C P Sbjct: 216 EEAFKRQFSKYISLGIKADDIENIYKNAHASIRKIPPSRRNPRRRSPRS-GGRWPSCRSP 274 Query: 104 PLRTTS 87 P R S Sbjct: 275 PARRRS 280 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 26.2 bits (55), Expect = 0.72 Identities = 11/31 (35%), Positives = 22/31 (70%) Frame = -1 Query: 432 FPSVNPGISWAPLRTITRAKTERLASTIHPR 340 +P + G + APLR+I + +++A+++HPR Sbjct: 408 WPDLGVG-NMAPLRSIGLTELDQIAASMHPR 437 >DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. Length = 407 Score = 25.4 bits (53), Expect = 1.3 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -3 Query: 184 PFIA*LISLYFGAHALFVKDTKLVLVHHFEQLLASRCRVRNV 59 PFIA + + G L + L+H F QL+A R R RNV Sbjct: 265 PFIADHVLVNVGTVDLLHGRAMIDLIHDFNQLVA-RFRERNV 305 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 24.6 bits (51), Expect = 2.2 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = -2 Query: 374 RPRDWRQQYIHELIYVFSLHRGAVCNMSGPLTSEDEHGCLS 252 +P+D+R+ + L VF +GA+ ++ T ED G S Sbjct: 856 KPKDFRKHSLLPLNNVFDRIKGALPHLKKSPTKEDATGGFS 896 >AF063021-3|AAC16247.1| 484|Anopheles gambiae dopa decarboxylase isoform 2 protein. Length = 484 Score = 24.6 bits (51), Expect = 2.2 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -2 Query: 164 QPLLRRPCAFRKRYEACAR 108 Q +RR CAF K++EA R Sbjct: 379 QAHIRRHCAFAKQFEALCR 397 >AF063021-2|AAC16249.1| 515|Anopheles gambiae dopa decarboxylase isoform 1 protein. Length = 515 Score = 24.6 bits (51), Expect = 2.2 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -2 Query: 164 QPLLRRPCAFRKRYEACAR 108 Q +RR CAF K++EA R Sbjct: 410 QAHIRRHCAFAKQFEALCR 428 >AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 24.2 bits (50), Expect = 2.9 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = -2 Query: 212 RQRHEVHSPSIHRLTDQPLLRRPCAFRKRYEACARPPLRTTSGIP 78 +Q+ ++HS + + RRP + + P L TTSG P Sbjct: 25 QQQQQLHSADVPHSSTSQSSRRPQHSSTSASSSSVPTLPTTSGEP 69 >AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 24.2 bits (50), Expect = 2.9 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = -2 Query: 212 RQRHEVHSPSIHRLTDQPLLRRPCAFRKRYEACARPPLRTTSGIP 78 +Q+ ++HS + + RRP + + P L TTSG P Sbjct: 25 QQQQQLHSADVPHSSTSQSSRRPQHSSTSASSSSVPTLPTTSGEP 69 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 23.8 bits (49), Expect = 3.9 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +1 Query: 379 SCYCAQGCPGN 411 +CYC CPGN Sbjct: 73 TCYCEGHCPGN 83 >AJ618918-1|CAF01997.1| 228|Anopheles gambiae putative odorant-binding protein OBPjj2 protein. Length = 228 Score = 23.8 bits (49), Expect = 3.9 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -1 Query: 240 FIGNPCLSLPPATRS 196 F GNPCL PP ++ Sbjct: 55 FAGNPCLKGPPVPKN 69 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.8 bits (49), Expect = 3.9 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +1 Query: 67 VPGNGMPEVVRSGGRAQA 120 VPG+G+P SGG A Sbjct: 3225 VPGSGLPAAAASGGAPSA 3242 >AM042695-1|CAJ14970.1| 396|Anopheles gambiae 3-hydroxykynurenine transaminase protein. Length = 396 Score = 23.0 bits (47), Expect = 6.7 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = +2 Query: 389 VRKGAQEIPGLTDGNVPRRLGPKRASKIRKLFNLSK 496 V GAQ++ G G P + PK IR SK Sbjct: 199 VYTGAQKVLGAPPGITPISISPKALDVIRNRRTKSK 234 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 627,097 Number of Sequences: 2352 Number of extensions: 14531 Number of successful extensions: 30 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 51722361 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -