BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11g09r (738 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g04310.1 68414.m00422 ethylene receptor-related similar to et... 29 4.3 At4g13800.1 68417.m02139 permease-related contains 9 predicted t... 28 5.6 At4g13560.1 68417.m02113 late embryogenesis abundant domain-cont... 28 5.6 At1g68050.1 68414.m07774 F-box family protein (FKF1) / adagio 3 ... 28 5.6 At5g23410.1 68418.m02745 expressed protein similar to Adagio 3 [... 28 7.4 At3g46690.1 68416.m05068 UDP-glucoronosyl/UDP-glucosyl transfera... 28 7.4 At5g67370.1 68418.m08495 expressed protein similar to unknown pr... 27 9.8 At2g45010.2 68415.m05605 expressed protein weak similarity to PG... 27 9.8 At2g45010.1 68415.m05604 expressed protein weak similarity to PG... 27 9.8 >At1g04310.1 68414.m00422 ethylene receptor-related similar to ethylene receptor CS-ETR2 [Cucumis sativus] GI:6136818; contains Pfam profiles PF01590: GAF domain, PF00512: His Kinase A (phosphoacceptor) domain Length = 645 Score = 28.7 bits (61), Expect = 4.3 Identities = 11/33 (33%), Positives = 21/33 (63%) Frame = +1 Query: 406 PTWLWLMTATSLWRLFML*LPCIWTLEVVTLVP 504 P W W+MTA +++++ + + L +VTL+P Sbjct: 110 PHWPWVMTAVTVFKMLTGIVSFLTALSLVTLLP 142 >At4g13800.1 68417.m02139 permease-related contains 9 predicted transmembrane domains; contains Pfam PF05653: Protein of unknown function (DUF803); identified as COG0697, Permeases of the drug/metabolite transporter (DMT) superfamily Length = 336 Score = 28.3 bits (60), Expect = 5.6 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +3 Query: 654 HKSSKMGVSTSVGGRTTHNP 713 HK+ MG STS+ G T+H+P Sbjct: 294 HKTKDMGNSTSLRGSTSHSP 313 >At4g13560.1 68417.m02113 late embryogenesis abundant domain-containing protein / LEA domain-containing protein similar to LEA protein [Cicer arietinum] GI:2909420; contains Pfam profile PF02987: Late embryogenesis abundant protein Length = 109 Score = 28.3 bits (60), Expect = 5.6 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +2 Query: 527 QKRG*TDEPGHPWTSSSEQRSQSGC 601 Q RG E WT S++Q +QS C Sbjct: 10 QNRGQAQEKAEQWTESAKQTAQSAC 34 >At1g68050.1 68414.m07774 F-box family protein (FKF1) / adagio 3 (ADO3) E3 ubiquitin ligase SCF complex F-box subunit; identical to FKF1 GI:6960305 and Adagio 3 GI:13487072 from [Arabidopsis thaliana]; contains Pfam profiles PF01344: Kelch motif, PF00785: PAC motif and PF00646: F-box domain; contains TIGRfam profile TIGR00229: PAS domain S-boxidentical to cDNA Adagio 3 (ADO3) GI:13487071 Length = 619 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = -2 Query: 572 WRSRDAQARQFTLAFGTANIFSGGTRVTTSSVHMHGSYNMNNLH 441 WR + + LA+G + GGTRV H + +N LH Sbjct: 564 WRILNVPGKPPKLAWGHSTCVVGGTRVLVLGGHTGEEWILNELH 607 >At5g23410.1 68418.m02745 expressed protein similar to Adagio 3 [Arabidopsis thaliana] GI:13487072/FKF1 [Arabidopsis thaliana] GI:6960305 Length = 84 Score = 27.9 bits (59), Expect = 7.4 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = -2 Query: 572 WRSRDAQARQFTLAFGTANIFSGGTRVTTSSVHMHGSYNMNNLH 441 WR + + LA+G + GGTRV H + +N LH Sbjct: 29 WRILNVPGKPPKLAWGHSTCVVGGTRVLVLGGHNGEEWILNELH 72 >At3g46690.1 68416.m05068 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 452 Score = 27.9 bits (59), Expect = 7.4 Identities = 16/31 (51%), Positives = 18/31 (58%), Gaps = 2/31 (6%) Frame = +1 Query: 586 VTERVLVSKEAPQIEVL--PFVSAITSPARW 672 VTER ++K APQIEVL P V S W Sbjct: 323 VTERGYIAKWAPQIEVLGHPAVGGFWSHCGW 353 >At5g67370.1 68418.m08495 expressed protein similar to unknown protein (gb|AAC18972.1) Length = 327 Score = 27.5 bits (58), Expect = 9.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -1 Query: 717 YQDCGWFCRQRWCSPPSCWTCDR 649 Y++ GW+ Q W PP DR Sbjct: 185 YEESGWYDGQMWVKPPEVLARDR 207 >At2g45010.2 68415.m05605 expressed protein weak similarity to PGPS/D12 [Petunia x hybrida] GI:4105794; contains Pfam profile PF04749: Protein of unknown function, DUF614 Length = 198 Score = 27.5 bits (58), Expect = 9.8 Identities = 10/39 (25%), Positives = 16/39 (41%) Frame = +2 Query: 275 GVFVGCWLPKQHRKFCRSRQPRPKYQQSCCFHWLG*CAE 391 G++ G + + +K+ P CC HW C E Sbjct: 102 GIYSGLFRQELQKKYHLKNAPCDHCMVHCCLHWCALCQE 140 >At2g45010.1 68415.m05604 expressed protein weak similarity to PGPS/D12 [Petunia x hybrida] GI:4105794; contains Pfam profile PF04749: Protein of unknown function, DUF614 Length = 244 Score = 27.5 bits (58), Expect = 9.8 Identities = 10/39 (25%), Positives = 16/39 (41%) Frame = +2 Query: 275 GVFVGCWLPKQHRKFCRSRQPRPKYQQSCCFHWLG*CAE 391 G++ G + + +K+ P CC HW C E Sbjct: 148 GIYSGLFRQELQKKYHLKNAPCDHCMVHCCLHWCALCQE 186 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,105,903 Number of Sequences: 28952 Number of extensions: 252757 Number of successful extensions: 950 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 917 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 948 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1624036432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -