BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11g05r (424 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25588| Best HMM Match : PAE (HMM E-Value=1.5e-31) 29 2.1 SB_17465| Best HMM Match : Dpy-30 (HMM E-Value=0.05) 28 2.8 SB_39205| Best HMM Match : Neur_chan_LBD (HMM E-Value=1.5e-09) 28 3.7 SB_3226| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=0.021) 27 4.8 SB_18018| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.4 SB_6699| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.4 SB_29818| Best HMM Match : zf-AD (HMM E-Value=1.3) 27 8.5 SB_49009| Best HMM Match : Ribosomal_S26e (HMM E-Value=7.3) 27 8.5 SB_46818| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 >SB_25588| Best HMM Match : PAE (HMM E-Value=1.5e-31) Length = 996 Score = 28.7 bits (61), Expect = 2.1 Identities = 11/37 (29%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Frame = +1 Query: 28 NIVEVQHLRHILGVGVYFDDVMFESRHF--WDIVVTP 132 N+ ++ +H++ G D M E++HF W++V P Sbjct: 361 NLGSSRNYKHLMDAGGILSDKMHENKHFHSWNVVYVP 397 >SB_17465| Best HMM Match : Dpy-30 (HMM E-Value=0.05) Length = 249 Score = 28.3 bits (60), Expect = 2.8 Identities = 17/57 (29%), Positives = 31/57 (54%), Gaps = 2/57 (3%) Frame = -2 Query: 222 IAGFATHLMRRLRHSQVRGISIKLQE--EERERRDNYVPEVSALEHDIIEVDPDTKD 58 I + ++MR+ R + R ++ +LQE E++R+D E++ L I +D KD Sbjct: 44 IRNLSRNIMRKWREAHERKVNKRLQELRIEKKRKDGEAKEIARLVTRKIPLDVLAKD 100 >SB_39205| Best HMM Match : Neur_chan_LBD (HMM E-Value=1.5e-09) Length = 1084 Score = 27.9 bits (59), Expect = 3.7 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = -2 Query: 114 PEVSALEHDIIEVDPDTKDMSKMLDFNNINGL 19 PE+S + H I PD +D +L+F+NI G+ Sbjct: 112 PEISKMLHHIY---PDLEDHESVLNFDNIKGV 140 >SB_3226| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=0.021) Length = 1217 Score = 27.5 bits (58), Expect = 4.8 Identities = 15/61 (24%), Positives = 31/61 (50%) Frame = -2 Query: 264 EEIAIIPTKPLRNKIAGFATHLMRRLRHSQVRGISIKLQEEERERRDNYVPEVSALEHDI 85 + + +P++ LRN++ + L R + Q I K +EE+ + NY+ + EH + Sbjct: 456 KNLQAMPSEGLRNQLTLMSVALQRSIFTIQHDHIKAKKREEQEQMAQNYL-RTARKEHKL 514 Query: 84 I 82 + Sbjct: 515 M 515 >SB_18018| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1040 Score = 27.1 bits (57), Expect = 6.4 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = -2 Query: 312 YYTRLTLDFDTNKRICEEIAIIPTKPLRNK 223 YY++LT D+D+ K EI I+P+ P+ K Sbjct: 14 YYSKLTHDYDSGKLQSPEI-ILPSVPVVTK 42 >SB_6699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1087 Score = 27.1 bits (57), Expect = 6.4 Identities = 13/48 (27%), Positives = 26/48 (54%) Frame = -2 Query: 201 LMRRLRHSQVRGISIKLQEEERERRDNYVPEVSALEHDIIEVDPDTKD 58 L +R RHS+ S + RE+ +++ ++ LE++ D DT++ Sbjct: 54 LEKRYRHSRKGTESHNTGTDTREKVLSHITQIQTLENESHNTDTDTRE 101 >SB_29818| Best HMM Match : zf-AD (HMM E-Value=1.3) Length = 275 Score = 26.6 bits (56), Expect = 8.5 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -3 Query: 176 KCEESLSNFRKRSVRGVTTMSQKCLL 99 KC SL F+K ++G T +S+K L+ Sbjct: 112 KCILSLGRFKKAKIKGQTFVSKKALV 137 >SB_49009| Best HMM Match : Ribosomal_S26e (HMM E-Value=7.3) Length = 163 Score = 26.6 bits (56), Expect = 8.5 Identities = 26/82 (31%), Positives = 36/82 (43%), Gaps = 2/82 (2%) Frame = -2 Query: 240 KPLRNKIAGFATHLMRRLRHSQVRGIS-IKLQEEERERRDNYVPEVSALEHDIIEVDPDT 64 K LR ++ FA+H RRLR + +R K+ + ++ Y P VS I D D Sbjct: 56 KALRGRVGLFASHCERRLRRTALRSRGWTKILKNHTLFQELY-PRVSRAISGTIIFDLDH 114 Query: 63 KDMSKM-LDFNNINGLXLRAAS 1 K S + L N L A S Sbjct: 115 KRRSTISLQDNTFPRQSLNAKS 136 >SB_46818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 26.6 bits (56), Expect = 8.5 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = -3 Query: 290 ILIQIKEYVKKSLSFLPSLLGIKLLDL 210 +L I+E K L+ LPSL+ +K LDL Sbjct: 219 LLAWIQEKRKNGLAILPSLIRMKALDL 245 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,367,812 Number of Sequences: 59808 Number of extensions: 199662 Number of successful extensions: 532 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 515 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 532 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 801830705 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -