BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11g04f (623 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_53171| Best HMM Match : SpdB (HMM E-Value=7.6) 28 7.1 SB_662| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 >SB_53171| Best HMM Match : SpdB (HMM E-Value=7.6) Length = 414 Score = 27.9 bits (59), Expect = 7.1 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -2 Query: 313 GGRSQNLILFIRGNAISGAPSI 248 GG S+NLI F G I G PS+ Sbjct: 99 GGESKNLINFALGQDIGGVPSV 120 >SB_662| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 27.5 bits (58), Expect = 9.4 Identities = 15/65 (23%), Positives = 24/65 (36%) Frame = -2 Query: 274 NAISGAPSIRGTNQFPNPPXXXXXXXXXXXXKACAVTIVL*I*SSPINDPGFPNSARIKS 95 NA+ +P + GTN P P ++ V + PG N +R S Sbjct: 68 NAVISSPQMNGTNGSPTPQSGKKTPSIRSGSSTSSIEFVRRHSFDADSGPGSANVSRFSS 127 Query: 94 LKDVP 80 + +P Sbjct: 128 FRVIP 132 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,138,448 Number of Sequences: 59808 Number of extensions: 203991 Number of successful extensions: 489 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 462 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 485 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1548368000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -