BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11g02f (614 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0204 + 1539859-1540158 30 1.3 04_04_1110 + 30973202-30973870 30 1.3 01_06_1057 - 34142979-34143114,34143212-34143390,34143496-341436... 29 2.9 05_04_0307 + 20066169-20066410,20066803-20066858,20067490-200675... 28 5.1 01_06_0034 + 25769436-25769701,25769749-25769887 28 6.8 12_02_0959 + 24818310-24818369,24818689-24819136,24819265-248194... 27 8.9 12_01_0574 - 4697425-4698312 27 8.9 02_05_1057 + 33809982-33810366,33810436-33810687,33810727-338109... 27 8.9 >12_01_0204 + 1539859-1540158 Length = 99 Score = 30.3 bits (65), Expect = 1.3 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +1 Query: 202 YAGSWSPPGASDIINFSGRVTDVKADD 282 +AGSW+ G + +F GRVT V+ D Sbjct: 38 HAGSWNGEGQGGLAHFGGRVTRVRRGD 64 >04_04_1110 + 30973202-30973870 Length = 222 Score = 30.3 bits (65), Expect = 1.3 Identities = 16/58 (27%), Positives = 28/58 (48%) Frame = -1 Query: 542 LDLTSPIVIAAPMSLTMMLSARETEAVASATTFSRASPPEAKDLRTRLKMRISPSAEP 369 L + + + +P S T+ S+R+T A A ++A P + L L M +A+P Sbjct: 97 LPKAAALAVVSPTSSTVESSSRDTPAAAPVAAAAKAQVPASPSLDLSLGMSAMVAAQP 154 >01_06_1057 - 34142979-34143114,34143212-34143390,34143496-34143669, 34143757-34144005,34144108-34144233,34144341-34144565, 34144657-34144747,34144837-34144951,34145312-34145366 Length = 449 Score = 29.1 bits (62), Expect = 2.9 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -1 Query: 86 CGTADTQARARAKMKAFIVDWIL 18 C DTQ +KM+A + DWI+ Sbjct: 210 CDYIDTQVEINSKMRAILADWII 232 >05_04_0307 + 20066169-20066410,20066803-20066858,20067490-20067581, 20068400-20068502,20068623-20068760,20068898-20069148 Length = 293 Score = 28.3 bits (60), Expect = 5.1 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +1 Query: 88 RDVDFEPNSQRILDIVISNLFNEIGELLRAAD 183 RDV+ PN + + D+ N +E+ ELL+ AD Sbjct: 219 RDVELSPNPEEVADVKYVNR-DELKELLKKAD 249 >01_06_0034 + 25769436-25769701,25769749-25769887 Length = 134 Score = 27.9 bits (59), Expect = 6.8 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = -3 Query: 507 DVTDNDVVCEGDGSGSLSNDVLKGKSSGSERPQDAAE 397 +V +D +C+G+G G + G ++ RPQ A E Sbjct: 16 EVESSDTICQGEGPGEGGHPDPAGPAAALLRPQVAGE 52 >12_02_0959 + 24818310-24818369,24818689-24819136,24819265-24819482, 24819651-24819929 Length = 334 Score = 27.5 bits (58), Expect = 8.9 Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 3/34 (8%) Frame = -3 Query: 507 DVTDNDVV---CEGDGSGSLSNDVLKGKSSGSER 415 ++ +ND++ C G G+GS S DVL +SG E+ Sbjct: 73 ELQENDLLFFTCNGHGNGSCSFDVLIFDASGCEK 106 >12_01_0574 - 4697425-4698312 Length = 295 Score = 27.5 bits (58), Expect = 8.9 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 6/52 (11%) Frame = +1 Query: 346 VPRVSASVGSAEGE------IRIFSRVLRSFASGGLALENVVAEATASVSLA 483 V + VG+AEGE +R+ +R R + S GLA+ +V A A+ +LA Sbjct: 220 VAAAAGDVGAAEGELREAQRLRVAARRRRLWLSAGLAVLLLVVLAAAAAALA 271 >02_05_1057 + 33809982-33810366,33810436-33810687,33810727-33810926, 33811021-33811122 Length = 312 Score = 27.5 bits (58), Expect = 8.9 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 492 DVVCEGDGSGSLSNDVLKGKSSGSERPQDAA 400 +V C G G G+++ D +G SG R DAA Sbjct: 120 NVGCIGGGGGNITVDGFRGGGSGGGRGGDAA 150 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,312,901 Number of Sequences: 37544 Number of extensions: 297417 Number of successful extensions: 1011 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 983 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1010 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1478421500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -