BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11g01f (600 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58590| Best HMM Match : Polysacc_deac_1 (HMM E-Value=2.6e-08) 154 5e-38 SB_4485| Best HMM Match : No HMM Matches (HMM E-Value=.) 133 9e-32 SB_641| Best HMM Match : No HMM Matches (HMM E-Value=.) 132 3e-31 SB_4469| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.94 SB_13326| Best HMM Match : RVT_1 (HMM E-Value=1.3) 31 0.94 SB_37209| Best HMM Match : Ion_trans (HMM E-Value=1.7e-05) 29 2.9 SB_59377| Best HMM Match : Exo_endo_phos (HMM E-Value=1.7) 29 3.8 SB_56758| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_33234| Best HMM Match : DNA_RNApol_7kD (HMM E-Value=3.9) 29 3.8 SB_9915| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 28 6.6 SB_47758| Best HMM Match : TFIIA (HMM E-Value=2.7e-18) 28 6.6 >SB_58590| Best HMM Match : Polysacc_deac_1 (HMM E-Value=2.6e-08) Length = 893 Score = 154 bits (374), Expect = 5e-38 Identities = 69/167 (41%), Positives = 96/167 (57%) Frame = +1 Query: 91 ATPCDEEACKLPDCRCSSTNIPGGLRARDTPQFVTVTFDDGINVINIETYREVLYGRSNS 270 A C + CKLP+C CS +PGGL ++ PQ + +TFDD IN Y+++ G+ N Sbjct: 566 AERCHPDVCKLPNCFCSGALVPGGLNPKEIPQMIMLTFDDAINGQVYPVYQKIFNGKKNP 625 Query: 271 NRCPAGATFYVSHEYTNYQLVNELYNRGFEIALHSISHRTPQAFWADATYQNLVQEIGDQ 450 N C ATF+VSHEYT YQL+ LY+ EIA HSISHR P +W +AT + E Sbjct: 626 NGCDIRATFFVSHEYTQYQLLQALYHERHEIADHSISHRLPIPWWKNATVKQWTDEAAGM 685 Query: 451 KRQMAHFASIPASAIKGVRIPFLQMSGNTSFQVMADFDLLYDCTWPT 591 + + F + A +KG R PFLQ+ G+ F+ + D Y+ + PT Sbjct: 686 REILRKFGGVNAEDVKGFRAPFLQIGGDNEFKALHDNKFTYETSMPT 732 >SB_4485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1769 Score = 133 bits (322), Expect = 9e-32 Identities = 61/148 (41%), Positives = 88/148 (59%) Frame = +1 Query: 148 NIPGGLRARDTPQFVTVTFDDGINVINIETYREVLYGRSNSNRCPAGATFYVSHEYTNYQ 327 ++P GL + PQ + +TFDD IN+ Y+ +L N N C ATF+VSHEYT+YQ Sbjct: 1555 SVPNGLDPKQIPQMIMLTFDDAINMQVFPFYQTLLNDTKNPNGCNVRATFFVSHEYTDYQ 1614 Query: 328 LVNELYNRGFEIALHSISHRTPQAFWADATYQNLVQEIGDQKRQMAHFASIPASAIKGVR 507 L+ LY+ EIA H+ISHRTP +W ATYQ+ EI + + F + ++G R Sbjct: 1615 LLGTLYHERHEIADHTISHRTPIEWWKKATYQDWGSEIRGMRDILKEFGGVNEKDVRGFR 1674 Query: 508 IPFLQMSGNTSFQVMADFDLLYDCTWPT 591 PFLQ+ G+ F+V+ D ++D + PT Sbjct: 1675 APFLQIGGDNQFKVLHDHSFMFDSSMPT 1702 >SB_641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 530 Score = 132 bits (318), Expect = 3e-31 Identities = 56/113 (49%), Positives = 76/113 (67%), Gaps = 1/113 (0%) Frame = +1 Query: 88 LATPCDEEACKLPDCRCSST-NIPGGLRARDTPQFVTVTFDDGINVINIETYREVLYGRS 264 +A CD E C+ P+CRCS PGGL TPQ + +TFDD I VIN E Y++ + G + Sbjct: 26 VAEKCDLEKCQPPNCRCSDDFQPPGGLSPALTPQIIMITFDDDITVINYEQYKDAVKGFT 85 Query: 265 NSNRCPAGATFYVSHEYTNYQLVNELYNRGFEIALHSISHRTPQAFWADATYQ 423 N N CP ATF++SH YTNY L +L++ G E+A H+++HRTP +W DATY+ Sbjct: 86 NPNGCPITATFFISHNYTNYYLAEKLHSEGHELADHTVTHRTPTTYWEDATYE 138 Score = 33.1 bits (72), Expect = 0.18 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +1 Query: 478 IPASAIKGVRIPFLQMSGNTSFQVMADFDLLYDCTWPT 591 +P+S IKG R PFL+++ + + + + YD +WPT Sbjct: 207 LPSSTIKGFRAPFLEITEH-QYPGLYTNNFTYDLSWPT 243 >SB_4469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 30.7 bits (66), Expect = 0.94 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +2 Query: 29 GCRFCALCSSWLRLLALSCHWLHHVTKRLVSSRTADAR 142 GCR CA S+ + + +L C W R +S+ T D R Sbjct: 80 GCRACARFSTTIFISSLVCDWPSKTRLRTISTFTQDRR 117 >SB_13326| Best HMM Match : RVT_1 (HMM E-Value=1.3) Length = 356 Score = 30.7 bits (66), Expect = 0.94 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 2/61 (3%) Frame = -1 Query: 375 RM*SNLEASIVEFVDQLIVCVLVADVEGSSGWA--AVRVAAAVKDLTVCLNVNDIDTVIE 202 R+ +L A + +DQL ++A V+G + W V V KDL +CL+ D++ I Sbjct: 72 RVPMSLHARLKGKLDQLERDGIIAKVDGPTDWVHNIVVVENKNKDLQMCLDPKDLNQAIR 131 Query: 201 R 199 R Sbjct: 132 R 132 >SB_37209| Best HMM Match : Ion_trans (HMM E-Value=1.7e-05) Length = 822 Score = 29.1 bits (62), Expect = 2.9 Identities = 17/66 (25%), Positives = 34/66 (51%), Gaps = 1/66 (1%) Frame = +1 Query: 169 ARDTPQF-VTVTFDDGINVINIETYREVLYGRSNSNRCPAGATFYVSHEYTNYQLVNELY 345 ARD + V D + ++N+E + G NS++ V+ + NY+++N L Sbjct: 89 ARDNDSVSLGVALDHYMELLNMEGLNDNNPGDPNSHKPKNFLPLVVAAQLGNYEVLNMLV 148 Query: 346 NRGFEI 363 ++GF++ Sbjct: 149 SKGFQL 154 >SB_59377| Best HMM Match : Exo_endo_phos (HMM E-Value=1.7) Length = 839 Score = 28.7 bits (61), Expect = 3.8 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = -2 Query: 206 SNVTVTNCG--VSLARNPPGILVDEHLQSGSLQASSSHGVANGSSVPRAAAT 57 +NVT +CG +SLA + + HL G L + G +N S + AT Sbjct: 148 NNVTHVDCGSIISLAPQDSRLHLSHHLPQGDLIFKLNPGPSNNGSAKKDCAT 199 >SB_56758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 335 Score = 28.7 bits (61), Expect = 3.8 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +2 Query: 50 CSSWLRLLALSCHWLHH 100 C+S LRLL LSC W H+ Sbjct: 115 CASSLRLLCLSCGWKHN 131 >SB_33234| Best HMM Match : DNA_RNApol_7kD (HMM E-Value=3.9) Length = 410 Score = 28.7 bits (61), Expect = 3.8 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +2 Query: 50 CSSWLRLLALSCHWLHH 100 C+S LRLL LSC W H+ Sbjct: 33 CASSLRLLCLSCGWKHN 49 >SB_9915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 304 Score = 28.3 bits (60), Expect = 5.0 Identities = 16/54 (29%), Positives = 25/54 (46%) Frame = +2 Query: 209 TVSMSLTLRHTVRSFXXXXXXXXXQPELPSTSATSTQTISWSTNSTIEASRLLY 370 TVS S+ RH SF ++ + + T+T+T + TN T E + Y Sbjct: 201 TVSWSIYRRHCGISFYVPAYNKTVYAKIGTLATTATRTTATKTNETFEEPDVKY 254 >SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) Length = 593 Score = 27.9 bits (59), Expect = 6.6 Identities = 15/37 (40%), Positives = 23/37 (62%), Gaps = 2/37 (5%) Frame = +1 Query: 145 TNIP--GGLRARDTPQFVTVTFDDGINVINIETYREV 249 T+IP G +R R T Q T+ D+G+ V ++ETY + Sbjct: 16 TDIPAKGSVRERQTVQVTTL--DNGLKVASLETYSPI 50 >SB_47758| Best HMM Match : TFIIA (HMM E-Value=2.7e-18) Length = 296 Score = 27.9 bits (59), Expect = 6.6 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +1 Query: 82 LPLATPCDEEACKLPDCRCSSTNIPGGLRARDTP 183 +P A + +P +S +IPGGL R TP Sbjct: 88 MPQAISRQPQQVTIPSTHVASVSIPGGLAQRQTP 121 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,552,950 Number of Sequences: 59808 Number of extensions: 455030 Number of successful extensions: 2004 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1898 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2000 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1451595000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -