BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11f19f (618 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20291| Best HMM Match : ATP-synt_ab (HMM E-Value=0) 75 5e-14 SB_21210| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_55653| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.32 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 29 4.0 SB_16595| Best HMM Match : Peptidase_A17 (HMM E-Value=9.1e-11) 28 7.0 SB_46088| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 >SB_20291| Best HMM Match : ATP-synt_ab (HMM E-Value=0) Length = 475 Score = 74.9 bits (176), Expect = 5e-14 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = +2 Query: 488 VGSHITGGDLYGIVHENTLVKHRMLVPPKAKGTVTYIAPAGNY 616 +G HITGGD+YG V ENT +KH +++ PKAKGT+TYIAP GNY Sbjct: 1 IGDHITGGDIYGYVQENTFIKHHIMLHPKAKGTITYIAPQGNY 43 >SB_21210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 428 Score = 40.3 bits (90), Expect = 0.001 Identities = 24/85 (28%), Positives = 42/85 (49%), Gaps = 4/85 (4%) Frame = +2 Query: 125 VFAVSGPVVTAEKMSGSAMYELVRVGY---NELVGEIIRLEGDMATIQVYEETSGVTVGD 295 V V+GP+V + + E+V + ++ GE++ + G A +QV+E TSG+ Sbjct: 17 VSGVNGPLVILDNVKFPKFAEIVTLTLQDGSQRSGEVLEVSGSKAVVQVFEGTSGIDAKH 76 Query: 296 PVLR-TGKPLSVELGPGILGSIFDG 367 TG L + +LG +F+G Sbjct: 77 TTCEFTGDILRTPVSEDMLGRVFNG 101 >SB_55653| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 390 Score = 32.3 bits (70), Expect = 0.32 Identities = 16/52 (30%), Positives = 26/52 (50%) Frame = +2 Query: 227 IRLEGDMATIQVYEETSGVTVGDPVLRTGKPLSVELGPGILGSIFDGIQRPL 382 + LE D + V+ + GD V RTG + V +G +LG + D + P+ Sbjct: 3 LNLEPDNVGVVVFGNDRLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNPI 54 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 28.7 bits (61), Expect = 4.0 Identities = 17/45 (37%), Positives = 23/45 (51%) Frame = -3 Query: 256 DGGHVTFKTDNLTDEFIVTDTDQLVHSRSGHLFGSDDGSRYGEDI 122 D H+T NLTD+ +T D + S HL SDD G+D+ Sbjct: 481 DDVHLTSDDGNLTDDVHLTSNDVYLTSDGVHL-TSDDVHLTGDDV 524 >SB_16595| Best HMM Match : Peptidase_A17 (HMM E-Value=9.1e-11) Length = 1692 Score = 27.9 bits (59), Expect = 7.0 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = -1 Query: 366 PSKMEPKIPGPSSTDKGFPVRSTGSPTVTPEVSS 265 P+ P IP S G+P +TG PT P SS Sbjct: 315 PTTGIPVIPQSSVLTPGYPSANTGYPTAIPGYSS 348 >SB_46088| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3306 Score = 27.5 bits (58), Expect = 9.2 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = -3 Query: 448 GQGRHVDTLGDVDGLSQLVDVLEGTLNTVKDGTQD 344 G H+ LGD Q + L G LNTV QD Sbjct: 480 GAETHLSNLGDAPSGKQELHALNGVLNTVDKHHQD 514 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,148,801 Number of Sequences: 59808 Number of extensions: 463226 Number of successful extensions: 1140 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 984 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1139 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1524174750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -