BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11f19f (618 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylch... 27 0.37 AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. 27 0.48 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 26 0.85 AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. 25 2.0 AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. 24 3.4 AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. 24 3.4 AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylch... 24 4.5 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 24 4.5 AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylch... 23 7.9 AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. 23 7.9 AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. 23 7.9 AM085517-1|CAJ30215.1| 339|Anopheles gambiae putative angiotens... 23 7.9 >AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 3 protein. Length = 710 Score = 27.5 bits (58), Expect = 0.37 Identities = 9/36 (25%), Positives = 21/36 (58%) Frame = +2 Query: 359 FDGIQRPLKDINELTQSIYIPKGINVPSLAREVDWE 466 +DG Q L+ I+E+ ++ + G+++ V+W+ Sbjct: 171 YDGFQVDLRHIDEMNETNVVEVGVDLSEFYTSVEWD 206 >AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. Length = 786 Score = 27.1 bits (57), Expect = 0.48 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +2 Query: 206 NELVGEIIRLEGDMATIQVYEETSGVTVGDPVLRTGKPLSVEL 334 N GEI R+ D+ ++V +E+ T GDP + SVE+ Sbjct: 547 NTQTGEI-RISRDVRFLEVDDESKEQTYGDPKIEDNPTESVEI 588 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 26.2 bits (55), Expect = 0.85 Identities = 21/74 (28%), Positives = 30/74 (40%), Gaps = 2/74 (2%) Frame = +2 Query: 395 ELTQSIYIPKGINVPSLAREVDWEFNPL--NVKVGSHITGGDLYGIVHENTLVKHRMLVP 568 E YIPKG + ++ ++ W P ++ SH GG I T K R Sbjct: 697 EAKNDAYIPKGGDKKIISTKLQWNAKPKIGSLDNASHKPGGGDKRIESIKTDFKERAKPK 756 Query: 569 PKAKGTVTYIAPAG 610 +K +TY P G Sbjct: 757 IGSKDNITY-KPGG 769 >AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. Length = 1132 Score = 25.0 bits (52), Expect = 2.0 Identities = 21/66 (31%), Positives = 30/66 (45%), Gaps = 4/66 (6%) Frame = -3 Query: 244 VTFKTDNLTDEFIVTDTDQLVHSRSGHLFGSDDGSRYGEDISE--PLLILLIGD--RPQT 77 V +TD T TDT+ ++ L S D SR GE + + L+ L GD R + Sbjct: 672 VKLETDAETAGGGATDTESVLGRAIADLVASGDDSRQGEMLRKLLALIKLFAGDVNRSRQ 731 Query: 76 AFARHF 59 A H+ Sbjct: 732 LLASHW 737 >AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 24.2 bits (50), Expect = 3.4 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -1 Query: 369 IPSKMEPKIPGPSSTDKGFPVRSTGSPTVT 280 + +K EP+ PG +T P +T PT T Sbjct: 84 VNAKCEPQSPGDQTTTTLRPATTTLRPTTT 113 >AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 24.2 bits (50), Expect = 3.4 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -1 Query: 369 IPSKMEPKIPGPSSTDKGFPVRSTGSPTVT 280 + +K EP+ PG +T P +T PT T Sbjct: 84 VNAKCEPQSPGDQTTTTLRPATTTLRPTTT 113 >AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 23.8 bits (49), Expect = 4.5 Identities = 11/41 (26%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +2 Query: 347 LGS-IFDGIQRPLKDINELTQSIYIPKGINVPSLAREVDWE 466 LGS +DG + L+ ++E + S + G+++ V+W+ Sbjct: 170 LGSWTYDGFKVDLRHMDEKSGSNIVDVGVDLSEFYMSVEWD 210 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 23.8 bits (49), Expect = 4.5 Identities = 17/45 (37%), Positives = 21/45 (46%), Gaps = 3/45 (6%) Frame = -3 Query: 451 PGQGRHVDTLGDVDGLSQLVDVLE---GTLNTVKDGTQDTGTKFY 326 PG+GR V DV+ L DV E G + D + DT K Y Sbjct: 2124 PGEGRGVGEAEDVEVPKALGDVFESIAGAIFLDSDMSLDTVWKVY 2168 >AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 23.0 bits (47), Expect = 7.9 Identities = 8/36 (22%), Positives = 20/36 (55%) Frame = +2 Query: 359 FDGIQRPLKDINELTQSIYIPKGINVPSLAREVDWE 466 +DG + L+ ++E + S + G+++ V+W+ Sbjct: 175 YDGFKVDLRHMDEKSGSNIVDVGVDLSEFYMSVEWD 210 >AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.0 bits (47), Expect = 7.9 Identities = 14/45 (31%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = +3 Query: 489 SGPTSPVEICMVLYTRT--LWSSTGCWSRPKPREQLPISHRPGTT 617 S PT+P + T T +W+ WS P RP TT Sbjct: 139 SAPTTPSQWTDPTITTTTPIWTDPTTWSAPTTTTTWSDQPRPPTT 183 >AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.0 bits (47), Expect = 7.9 Identities = 14/45 (31%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = +3 Query: 489 SGPTSPVEICMVLYTRT--LWSSTGCWSRPKPREQLPISHRPGTT 617 S PT+P + T T +W+ WS P RP TT Sbjct: 139 SAPTTPSQWTDPTITTTTPIWTDPTTWSAPTTTTTWSDQPRPPTT 183 >AM085517-1|CAJ30215.1| 339|Anopheles gambiae putative angiotensin converting enzymeprecursor protein. Length = 339 Score = 23.0 bits (47), Expect = 7.9 Identities = 13/42 (30%), Positives = 18/42 (42%) Frame = -3 Query: 157 GSDDGSRYGEDISEPLLILLIGDRPQTAFARHFELVILYPRR 32 G + Y D+ PLL GDR + + E +LY R Sbjct: 143 GDRSPNPYVSDVDNPLLYRDGGDRNRNRYVSDVENPLLYRDR 184 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 698,734 Number of Sequences: 2352 Number of extensions: 14914 Number of successful extensions: 48 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 45 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 48 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 60553008 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -