BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11f18r (703 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 23 2.1 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 23 3.7 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 23 3.7 DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 23 3.7 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 23 3.7 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 23.4 bits (48), Expect = 2.1 Identities = 11/39 (28%), Positives = 17/39 (43%) Frame = +1 Query: 109 LSVFINCW*PTTW*SSVNKLFSTPQAKKSWTACSACWVG 225 +S FI CW P + V P A ++ + W+G Sbjct: 378 MSAFIVCWLPFFVLALVRPFLKNPDAIPAFLSSLFLWLG 416 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 22.6 bits (46), Expect = 3.7 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +3 Query: 222 RQLLPKVSNETDPYGYIIVV 281 R LLPK E PY ++VV Sbjct: 601 RLLLPKGKKEGMPYNVLVVV 620 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 22.6 bits (46), Expect = 3.7 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +2 Query: 632 RSPKNTNSMYEKNCTAII 685 + PKNTN EK A+I Sbjct: 143 QEPKNTNKFLEKGPVALI 160 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 22.6 bits (46), Expect = 3.7 Identities = 8/21 (38%), Positives = 16/21 (76%) Frame = +3 Query: 309 SRSFINFSVASSHE*IAQVLE 371 +RSF+ FS+ S + +A+V++ Sbjct: 295 ARSFVPFSIERSSQSVAEVMD 315 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 22.6 bits (46), Expect = 3.7 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +3 Query: 222 RQLLPKVSNETDPYGYIIVV 281 R LLPK E PY ++VV Sbjct: 601 RLLLPKGKKEGMPYNVLVVV 620 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 211,525 Number of Sequences: 438 Number of extensions: 4962 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21561255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -