BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11f15r (736 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC2D10.17 |clr1||cryptic loci regulator Clr1|Schizosaccharomyc... 26 6.4 SPAC694.03 |||conserved fungal protein|Schizosaccharomyces pombe... 25 8.5 >SPBC2D10.17 |clr1||cryptic loci regulator Clr1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1238 Score = 25.8 bits (54), Expect = 6.4 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = -1 Query: 460 SHQSNQNTICKIKMFYNFQVKPYIQLSTQTGS 365 S N +C+ K FY Q +P+ L + S Sbjct: 175 SSSQNPGLVCEQKTFYQHQFRPFSNLPSNKSS 206 >SPAC694.03 |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 249 Score = 25.4 bits (53), Expect = 8.5 Identities = 17/48 (35%), Positives = 24/48 (50%) Frame = +1 Query: 379 LIAVCTVSPGNYRTSLFYRLCFDLTGDLFPISFRYLV*Y**LIKLSYC 522 LI CTVS + +LF C ++ L P YLV + LI++ C Sbjct: 92 LIHNCTVSVAICKHALFVDKCRSISNKLGPREQVYLVGFDTLIRILDC 139 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,536,979 Number of Sequences: 5004 Number of extensions: 45775 Number of successful extensions: 71 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 70 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 71 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 347244562 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -