BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11f15f (632 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1486.04c |alm1||medial ring protein Alm1|Schizosaccharomyces... 26 5.2 SPBC1A4.10c |pmc1|SPBP23A10.01c, med14|mediator complex subunit ... 25 6.9 >SPAC1486.04c |alm1||medial ring protein Alm1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1727 Score = 25.8 bits (54), Expect = 5.2 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = -1 Query: 608 NTIVQNLHTLQMIIKFVQRNTRNANVLNQSLLN 510 N + +N +TL IK ++ ++ + N+SLLN Sbjct: 576 NAVKENSNTLSEQIKNLESELNSSKIKNESLLN 608 >SPBC1A4.10c |pmc1|SPBP23A10.01c, med14|mediator complex subunit Pmc1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 879 Score = 25.4 bits (53), Expect = 6.9 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -1 Query: 626 ENPCSKNTIVQNLHTLQMIIK 564 E+P S I+Q LH L M+I+ Sbjct: 146 ESPLSTKQILQTLHALNMLIR 166 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,418,183 Number of Sequences: 5004 Number of extensions: 46150 Number of successful extensions: 82 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 81 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 82 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 281707720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -