BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11f15f (632 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_02_0550 - 11413912-11414079,11414338-11414513,11414617-114146... 30 1.8 01_01_1120 - 8884760-8885017,8886088-8886150,8887365-8887627,888... 28 5.4 >02_02_0550 - 11413912-11414079,11414338-11414513,11414617-11414629, 11414844-11414871,11415447-11415784 Length = 240 Score = 29.9 bits (64), Expect = 1.8 Identities = 12/31 (38%), Positives = 21/31 (67%) Frame = -2 Query: 193 LMNIIVRGRSQGYLKLWVSHQYRTSNFNLPL 101 ++ +I++G S GY K+W H+YR N N+ + Sbjct: 120 VIKVILQGLSMGYKKVW-WHKYRNLNKNIDI 149 >01_01_1120 - 8884760-8885017,8886088-8886150,8887365-8887627, 8887728-8887882,8888194-8888465,8889593-8889735, 8890150-8890444 Length = 482 Score = 28.3 bits (60), Expect = 5.4 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = -3 Query: 495 ISAHTSSKYFKDRTHSELK 439 I +HT+++Y+K RTH LK Sbjct: 219 IDSHTTAEYWKTRTHDRLK 237 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,650,101 Number of Sequences: 37544 Number of extensions: 229670 Number of successful extensions: 325 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 321 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 325 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1549385732 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -