BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11f12f (421 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z22930-3|CAA80515.1| 275|Anopheles gambiae trypsin protein. 25 1.5 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 6.0 AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 22 7.9 AF515471-1|AAM61879.1| 225|Anopheles gambiae glutathione S-tran... 22 7.9 AF491816-1|AAM09542.2| 225|Anopheles gambiae glutathione S-tran... 22 7.9 >Z22930-3|CAA80515.1| 275|Anopheles gambiae trypsin protein. Length = 275 Score = 24.6 bits (51), Expect = 1.5 Identities = 9/36 (25%), Positives = 18/36 (50%) Frame = +2 Query: 314 YVXFAVNHPEFSEENYXKDVSIVRVTHAIHFGPNIQ 421 +V V HP++ +E D S++ + + F +Q Sbjct: 116 HVARIVQHPDYDQETIDYDYSLLELESVLTFSNKVQ 151 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 22.6 bits (46), Expect = 6.0 Identities = 6/23 (26%), Positives = 14/23 (60%) Frame = +2 Query: 314 YVXFAVNHPEFSEENYXKDVSIV 382 ++ +HP F+ NY +++ +V Sbjct: 369 FINIQAHHPNFTTLNYFRNLEVV 391 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 22.2 bits (45), Expect = 7.9 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +3 Query: 195 FSPTTTTFQLLPVSMENSTXLHTVALSXDLPV 290 +SP TTT P++ NS L + LS L V Sbjct: 163 YSPRTTTTPEPPLADPNSMHLFALTLSVCLCV 194 >AF515471-1|AAM61879.1| 225|Anopheles gambiae glutathione S-transferase 3-8 protein. Length = 225 Score = 22.2 bits (45), Expect = 7.9 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = -1 Query: 187 SALLEPLIQDG*EYFNLDQXGXLXNRXRSTE 95 S L EP+I G YF+ D+ + R E Sbjct: 114 SFLFEPVIYSGKSYFHSDRIEHIRKAYRLLE 144 >AF491816-1|AAM09542.2| 225|Anopheles gambiae glutathione S-transferase E7 protein. Length = 225 Score = 22.2 bits (45), Expect = 7.9 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = -1 Query: 187 SALLEPLIQDG*EYFNLDQXGXLXNRXRSTE 95 S L EP+I G YF+ D+ + R E Sbjct: 114 SFLFEPVIYSGKSYFHSDRIEHIRKAYRLLE 144 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 393,289 Number of Sequences: 2352 Number of extensions: 6108 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 34632603 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -