BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11f11f (579 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_06_0120 + 31804301-31804412,31804525-31804631,31804714-318047... 31 0.50 10_02_0174 - 6202334-6204922 30 1.5 >03_06_0120 + 31804301-31804412,31804525-31804631,31804714-31804756, 31806069-31806187 Length = 126 Score = 31.5 bits (68), Expect = 0.50 Identities = 15/49 (30%), Positives = 22/49 (44%) Frame = +3 Query: 168 WKRMSFFVAFPAIALGMLNAYLAHQEEHHERPPFVPYEYMRIRTKRFPW 314 W+++++ L N H H + PP Y Y+ IR K FPW Sbjct: 43 WEKITYAGIVTCTLLAAYNLSKGHP--HFDEPP--AYPYLHIRNKEFPW 87 >10_02_0174 - 6202334-6204922 Length = 862 Score = 29.9 bits (64), Expect = 1.5 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 2/58 (3%) Frame = +3 Query: 234 AHQEEHHERPPFVPYEYMRIRTKRFPW-GDGQ-KSLFHNPHVNALPSGYEDDH*ITII 401 A E H+ Y M + W GDG S+ +NPH+ A GY+ D ++II Sbjct: 346 ASSESKHKPKWLDDYSAMITQAVLTGWFGDGMANSVMYNPHLVARQFGYDQDFPVSII 403 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,728,881 Number of Sequences: 37544 Number of extensions: 268641 Number of successful extensions: 542 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 536 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 542 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1352600424 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -