BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11f11f (579 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g37830.1 68417.m05352 cytochrome c oxidase-related contains w... 38 0.006 At4g16745.1 68417.m02529 exostosin family protein contains Pfam ... 33 0.14 At4g20140.1 68417.m02947 leucine-rich repeat transmembrane prote... 31 0.42 At2g32415.1 68415.m03961 3'-5' exonuclease domain-containing pro... 27 6.8 At1g23880.1 68414.m03012 NHL repeat-containing protein contains ... 27 6.8 At5g52530.2 68418.m06518 dentin sialophosphoprotein-related cont... 27 9.0 At5g52530.1 68418.m06517 dentin sialophosphoprotein-related cont... 27 9.0 At3g58810.2 68416.m06555 zinc transporter, putative similar to z... 27 9.0 At3g58810.1 68416.m06554 zinc transporter, putative similar to z... 27 9.0 >At4g37830.1 68417.m05352 cytochrome c oxidase-related contains weak similarity to cytochrome c oxidase polypeptide VIa-liver, mitochondrial precursor (EC 1.9.3.1) (Swiss-Prot:P10818) [Rattus norvegicus] Length = 102 Score = 37.5 bits (83), Expect = 0.006 Identities = 22/61 (36%), Positives = 32/61 (52%), Gaps = 2/61 (3%) Frame = +3 Query: 168 WKRMSFFVAFPAIALGMLNAYLAHQEEHH-ERPPFVPYEYMRIRTKRFPWG-DGQKSLFH 341 W+++++ AL + Y+ + HH E PP Y +M IR K FPWG DG + H Sbjct: 44 WEKITYLGIASCTALAV---YVLSKGHHHGEDPP--AYPHMHIRNKEFPWGPDGLFEVKH 98 Query: 342 N 344 N Sbjct: 99 N 99 >At4g16745.1 68417.m02529 exostosin family protein contains Pfam PF03016: Exostosin family Length = 542 Score = 33.1 bits (72), Expect = 0.14 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +3 Query: 276 YEYMRIRTKRFPWGDGQKSLFHNPHVNAL 362 YE M + K + + DG K +FH PH+N + Sbjct: 193 YELMELILKVYIYPDGDKPIFHEPHLNGI 221 >At4g20140.1 68417.m02947 leucine-rich repeat transmembrane protein kinase, putative Cf-2.2, Lycopersicon pimpinellifolium, PIR:T10515 Length = 1249 Score = 31.5 bits (68), Expect = 0.42 Identities = 17/31 (54%), Positives = 23/31 (74%), Gaps = 3/31 (9%) Frame = -3 Query: 97 KEIAALRRIEVIFLWELNRYE*NIK---GNC 14 KEI+ALR++EV+FL+E NR+ I GNC Sbjct: 426 KEISALRKLEVLFLYE-NRFSGEIPQEIGNC 455 >At2g32415.1 68415.m03961 3'-5' exonuclease domain-containing protein similar to SP|Q12149 Exosome complex exonuclease RRP6 (EC 3.1.13.-) (Ribosomal RNA processing protein 6) {Saccharomyces cerevisiae} Length = 880 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -3 Query: 316 PHGKRFVRMRMYS*GTNGGRSWCSSW 239 PHGK+ V + G +G R +C W Sbjct: 813 PHGKQIVEYLLREHGEDGVRDFCQRW 838 >At1g23880.1 68414.m03012 NHL repeat-containing protein contains Pfam profile PF01436: NHL repeat Length = 545 Score = 27.5 bits (58), Expect = 6.8 Identities = 12/40 (30%), Positives = 17/40 (42%) Frame = +3 Query: 237 HQEEHHERPPFVPYEYMRIRTKRFPWGDGQKSLFHNPHVN 356 + HH P+ YE +T +G GQ+ N H N Sbjct: 489 YHHRHHSTIPYTLYEQSSEKTNEIVFGPGQEQDQMNTHQN 528 >At5g52530.2 68418.m06518 dentin sialophosphoprotein-related contains weak similarity to dentin sialophosphoprotein precursor (Dentin matrix protein-3) (DMP- 3) (Swiss-Prot:P97399) [Mus musculus] Length = 828 Score = 27.1 bits (57), Expect = 9.0 Identities = 12/32 (37%), Positives = 16/32 (50%), Gaps = 2/32 (6%) Frame = -1 Query: 390 FSGHLHNRWEGHSHEGCGKGT--SVHHPMGNA 301 FSG +HNR G+ E G +HHP + Sbjct: 627 FSGRMHNRMSGNRRERGGSPVVRRLHHPQSES 658 >At5g52530.1 68418.m06517 dentin sialophosphoprotein-related contains weak similarity to dentin sialophosphoprotein precursor (Dentin matrix protein-3) (DMP- 3) (Swiss-Prot:P97399) [Mus musculus] Length = 828 Score = 27.1 bits (57), Expect = 9.0 Identities = 12/32 (37%), Positives = 16/32 (50%), Gaps = 2/32 (6%) Frame = -1 Query: 390 FSGHLHNRWEGHSHEGCGKGT--SVHHPMGNA 301 FSG +HNR G+ E G +HHP + Sbjct: 627 FSGRMHNRMSGNRRERGGSPVVRRLHHPQSES 658 >At3g58810.2 68416.m06555 zinc transporter, putative similar to zinc transporter 4; ZnT4 [Mus musculus] gi|2582990|gb|AAB82593; similar to zinc transporter ZAT [Arabidopsis thaliana] gi|4206640|gb|AAD11757; member of the cation diffusion facilitator (CDF) family, or cation efflux (CE) family, PMID:11500563 Length = 393 Score = 27.1 bits (57), Expect = 9.0 Identities = 11/24 (45%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = -1 Query: 384 GHLHNRWEGHSHE-GCGKGTSVHH 316 GH H+ GHSH+ G G + HH Sbjct: 205 GHSHDNGHGHSHDHGHGIAATEHH 228 >At3g58810.1 68416.m06554 zinc transporter, putative similar to zinc transporter 4; ZnT4 [Mus musculus] gi|2582990|gb|AAB82593; similar to zinc transporter ZAT [Arabidopsis thaliana] gi|4206640|gb|AAD11757; member of the cation diffusion facilitator (CDF) family, or cation efflux (CE) family, PMID:11500563 Length = 432 Score = 27.1 bits (57), Expect = 9.0 Identities = 11/24 (45%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = -1 Query: 384 GHLHNRWEGHSHE-GCGKGTSVHH 316 GH H+ GHSH+ G G + HH Sbjct: 244 GHSHDNGHGHSHDHGHGIAATEHH 267 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,408,208 Number of Sequences: 28952 Number of extensions: 221709 Number of successful extensions: 439 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 425 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 438 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1131744440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -