BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11f07r (748 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC330.11 |btb1||BTB/POZ domain protein Btb1|Schizosaccharomyce... 29 0.53 SPAC343.18 |rfp2||ubiquitin-protein ligase E3 Rfp2|Schizosacchar... 27 3.8 SPBC1718.01 |pop1|ste16, SPBC2G2.18|F-box/WD repeat protein Pop1... 25 8.7 >SPCC330.11 |btb1||BTB/POZ domain protein Btb1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1347 Score = 29.5 bits (63), Expect = 0.53 Identities = 15/53 (28%), Positives = 23/53 (43%) Frame = -3 Query: 632 FKFCPSWVFRRSSTARIPV*PRSWITTSRCTYPRLCKKPSLKSTRKAPKQPPP 474 FKF P W+F S A + + + + CT C K L+S ++ P Sbjct: 454 FKFTPLWIFESSDLAALDIAWTADNSLILCTRNGTCWKRELRSKKREKSSSSP 506 >SPAC343.18 |rfp2||ubiquitin-protein ligase E3 Rfp2|Schizosaccharomyces pombe|chr 1|||Manual Length = 205 Score = 26.6 bits (56), Expect = 3.8 Identities = 13/46 (28%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = -1 Query: 439 RRTVHSIFCGQQTISGCDSRTRNSMLPCAFSRVEQSI-HKFIFYTY 305 ++++ + CG S C R +PC + I KFIF Y Sbjct: 159 KKSIFAAKCGHLFCSTCAKELRKKTVPCPVQHCRKRITKKFIFPLY 204 >SPBC1718.01 |pop1|ste16, SPBC2G2.18|F-box/WD repeat protein Pop1|Schizosaccharomyces pombe|chr 2|||Manual Length = 775 Score = 25.4 bits (53), Expect = 8.7 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -1 Query: 394 GCDSRTRNSMLPCAFSRVEQSIHKFIFYTY 305 G DS+TR S P + S S+H+ + Y + Sbjct: 202 GNDSKTRQSFPPHSSSSSHNSLHEPVIYDF 231 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,897,575 Number of Sequences: 5004 Number of extensions: 56420 Number of successful extensions: 158 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 156 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 158 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 355273338 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -