BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11f07f (584 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20424| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_38792| Best HMM Match : 7tm_2 (HMM E-Value=2e-13) 27 8.5 SB_43550| Best HMM Match : Laminin_EGF (HMM E-Value=0) 27 8.5 >SB_20424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1711 Score = 27.9 bits (59), Expect = 6.4 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +2 Query: 428 DYELDPKLKKDAVEVFDADFEKVNFDNGAAAAGL 529 DY++D KL DA + D +FE+++ +N A L Sbjct: 373 DYQVDYKLLLDAKKKLDTEFEELSKNNSEREAVL 406 >SB_38792| Best HMM Match : 7tm_2 (HMM E-Value=2e-13) Length = 1287 Score = 27.5 bits (58), Expect = 8.5 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +3 Query: 210 KRRMLYHRHCQQNTCWR 260 K RM + + CQ+N CWR Sbjct: 561 KARMFWAQCCQKNACWR 577 >SB_43550| Best HMM Match : Laminin_EGF (HMM E-Value=0) Length = 1182 Score = 27.5 bits (58), Expect = 8.5 Identities = 16/49 (32%), Positives = 22/49 (44%) Frame = -3 Query: 369 NFDDTAENDERIVSSSGIPRLVNSSSCAGSVVPKVINASKYSADNGDDT 223 N DD D+R SS+G V+ + + N +KY N DDT Sbjct: 184 NIDDGNNVDDR--SSNGNNNNVDQDNNDDETITTTTNKNKYDGGNNDDT 230 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,820,942 Number of Sequences: 59808 Number of extensions: 290487 Number of successful extensions: 644 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 585 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 637 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1410146228 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -