BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11f05r (719 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY745205-1|AAU93472.1| 91|Anopheles gambiae cytochrome P450 pr... 28 0.33 Y09952-1|CAA71083.1| 115|Anopheles gambiae histone H3 protein. 24 4.1 AY035716-1|AAK61362.1| 136|Anopheles gambiae histone 3A protein. 24 4.1 >AY745205-1|AAU93472.1| 91|Anopheles gambiae cytochrome P450 protein. Length = 91 Score = 27.9 bits (59), Expect = 0.33 Identities = 16/52 (30%), Positives = 25/52 (48%) Frame = -3 Query: 240 PCNDYVNTATRHVLLRQGVLGIKVKIMLPWDQQGKNGPKKPQPDHILVTEPK 85 P +DYV TRH++ + V+ I + + D P++ PD L E K Sbjct: 10 PSSDYVIPGTRHIVPKDTVVQIPI-YAIQRDPDHYPDPERFDPDRFLPEEVK 60 >Y09952-1|CAA71083.1| 115|Anopheles gambiae histone H3 protein. Length = 115 Score = 24.2 bits (50), Expect = 4.1 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = -2 Query: 457 GGYSWSLRYRPGRISKIQAYRRSRCTSCLLWCSPF 353 GG RYRPG ++ + R + T L+ PF Sbjct: 32 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 66 >AY035716-1|AAK61362.1| 136|Anopheles gambiae histone 3A protein. Length = 136 Score = 24.2 bits (50), Expect = 4.1 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = -2 Query: 457 GGYSWSLRYRPGRISKIQAYRRSRCTSCLLWCSPF 353 GG RYRPG ++ + R + T L+ PF Sbjct: 34 GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPF 68 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 773,021 Number of Sequences: 2352 Number of extensions: 16719 Number of successful extensions: 43 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 41 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 43 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73181328 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -