BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11f05r (719 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 25 0.95 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 25 0.95 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 25 0.95 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 24 1.7 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 21 8.9 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 24.6 bits (51), Expect = 0.95 Identities = 12/45 (26%), Positives = 20/45 (44%) Frame = -3 Query: 135 NGPKKPQPDHILVTEPKDEPVPLEPTSEVRSLAPAPLPQPVRRCR 1 +GP + D I K+ + L S+ + P P P P ++ R Sbjct: 351 SGPDSAKLDKIFDIATKENAMLLSGRSQKSTTGPPPGPTPAQKAR 395 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 24.6 bits (51), Expect = 0.95 Identities = 13/50 (26%), Positives = 21/50 (42%) Frame = +1 Query: 250 VDHESIYKLH*FGTLTTQLARYNNFTTTGARFHDETENTIASTTYSETSD 399 VD + K T+ T L +Y N+T F + + TY +T + Sbjct: 1162 VDEMEVRKTSALTTVLTGLRKYTNYTIQVLAFTRVGDGVPTTVTYCQTEE 1211 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 24.6 bits (51), Expect = 0.95 Identities = 13/50 (26%), Positives = 21/50 (42%) Frame = +1 Query: 250 VDHESIYKLH*FGTLTTQLARYNNFTTTGARFHDETENTIASTTYSETSD 399 VD + K T+ T L +Y N+T F + + TY +T + Sbjct: 1158 VDEMEVRKTSALTTVLTGLRKYTNYTIQVLAFTRVGDGVPTTVTYCQTEE 1207 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -2 Query: 613 SPGHSHPLGDHYYGHQDTKCARRERT 536 S H PL +H Y D+ + ERT Sbjct: 1323 SEDHRRPLSEHIYSSIDSDYSTLERT 1348 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 21.4 bits (43), Expect = 8.9 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +1 Query: 430 DSAKTTSSHLFSIQFYRLLWNVESLLYYGSQ 522 D + S+H +I Y LW ++S L +Q Sbjct: 122 DCSGIVSAHKIAIDEYERLWVLDSGLVNNTQ 152 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 199,155 Number of Sequences: 438 Number of extensions: 4491 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22292145 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -