BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11f03r (736 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12802| Best HMM Match : Aldedh (HMM E-Value=0) 33 0.24 SB_6623| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_55803| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_31467| Best HMM Match : CTP_transf_2 (HMM E-Value=0.85) 29 3.0 SB_34603| Best HMM Match : DUF1211 (HMM E-Value=3.3) 29 3.0 SB_35884| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_25814| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_43399| Best HMM Match : No HMM Matches (HMM E-Value=.) 24 5.7 SB_50535| Best HMM Match : PPE (HMM E-Value=1.1) 28 9.0 SB_51848| Best HMM Match : DUF1135 (HMM E-Value=6.4e-09) 28 9.0 SB_207| Best HMM Match : RVT_1 (HMM E-Value=7.4e-06) 23 9.7 >SB_12802| Best HMM Match : Aldedh (HMM E-Value=0) Length = 880 Score = 33.1 bits (72), Expect = 0.24 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = -2 Query: 576 TEVGEFVGSFFAIFIIALLYEGLKYYRKHL 487 T +GS A+FI+A+LYEGLK R+ L Sbjct: 122 TSTPGMIGSCIAVFILAVLYEGLKVSREML 151 >SB_6623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 32.7 bits (71), Expect = 0.32 Identities = 15/45 (33%), Positives = 27/45 (60%) Frame = +1 Query: 160 VTMFSEVNNYRFAPTKEEVPCR*S*YYSSAQPCVVSHKNQHQHIT 294 + +F V+N P+KE+VP + AQP ++ H+++HQ +T Sbjct: 47 MAVFINVHNLGKFPSKEKVPEASTQRNCYAQPTIIRHEDKHQKVT 91 >SB_55803| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 29.9 bits (64), Expect = 2.2 Identities = 22/82 (26%), Positives = 35/82 (42%), Gaps = 1/82 (1%) Frame = -2 Query: 735 NSSYTRIVHNTDMNDHNVHTFSGHGDHSSHNMGMSMTFHGGYIETILFSWWNVTEVGEFV 556 N++ +HNT HN + + + HN S T H TI +WW +T F Sbjct: 94 NTTRHNSLHNTTR--HNSLPNTTRHNTTRHNSLNSTTMHNSLPNTIRTTWWPITFFSSFS 151 Query: 555 GSF-FAIFIIALLYEGLKYYRK 493 + +A + L++YRK Sbjct: 152 FMWNWAKLTTWSVGTDLRFYRK 173 >SB_31467| Best HMM Match : CTP_transf_2 (HMM E-Value=0.85) Length = 1459 Score = 29.5 bits (63), Expect = 3.0 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = -2 Query: 324 TILHGVQVLVSYMLMLVFMTYNTWLCAAVVLGSATGYFLF 205 T + V V+VS + + + Y TWL V GS +FLF Sbjct: 1349 TFVFAVCVIVSNLKLALVTHYWTWLTHVVTWGSILTFFLF 1388 >SB_34603| Best HMM Match : DUF1211 (HMM E-Value=3.3) Length = 143 Score = 29.5 bits (63), Expect = 3.0 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = -2 Query: 324 TILHGVQVLVSYMLMLVFMTYNTWLCAAVVLGSATGYFLF 205 T + V V+VS + + + Y TWL V GS +FLF Sbjct: 33 TFVFAVCVIVSNLKLALVTHYWTWLTHVVTWGSILTFFLF 72 >SB_35884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 29.1 bits (62), Expect = 3.9 Identities = 12/53 (22%), Positives = 22/53 (41%) Frame = +1 Query: 253 PCVVSHKNQHQHITN*HLNPMKYRLPCVCCAHHRRNISFKHMRNWLYNLWFIC 411 P +V N H+ ++ H P+ C H R I + ++ L ++C Sbjct: 22 PLLVRSSNTHRRVSRIHSEPLLIESSTRCAVHQRNTIRQANRQHTALRLKYLC 74 >SB_25814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 321 Score = 28.7 bits (61), Expect = 5.2 Identities = 16/63 (25%), Positives = 29/63 (46%), Gaps = 2/63 (3%) Frame = -2 Query: 363 NVPTMMSTAHAWQTILHGVQVLVSYMLMLVFMTYNTWLCAAVVLGSATGYFLFG--WRES 190 N+ M ST + I H V V+Y L+ + + Y + +++ YFL W E Sbjct: 204 NISNMSSTQVTQEAIEHRVAATVAYSLVALAICYIPIIVVSILRSLGNNYFLLTAIWMEM 263 Query: 189 VVV 181 +++ Sbjct: 264 LLL 266 >SB_43399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 953 Score = 23.8 bits (49), Expect(2) = 5.7 Identities = 14/49 (28%), Positives = 22/49 (44%), Gaps = 3/49 (6%) Frame = -2 Query: 366 RNVP---TMMSTAHAWQTILHGVQVLVSYMLMLVFMTYNTWLCAAVVLG 229 +N+P T T H WQ++L + + Y V+ T L +V G Sbjct: 286 KNIPLIATRSITTHLWQSLLRAILLAFKYFYG-VYTTSRDCLWRRIVYG 333 Score = 23.0 bits (47), Expect(2) = 5.7 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = -2 Query: 441 PDKGVANICAADEPQIVQPIPHMLERNV 358 P G ++C A +VQP H L + + Sbjct: 235 PSVGRFSVCVAQSQIVVQPKHHELTKRI 262 >SB_50535| Best HMM Match : PPE (HMM E-Value=1.1) Length = 299 Score = 27.9 bits (59), Expect = 9.0 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = +1 Query: 88 LSSIRNKVFTTNTNHHYNCEHFSSVTMFSEVNNYRFAPTKEEVPC 222 L S+ N + T H YN + + + N YRFA + PC Sbjct: 87 LKSVVNNM--TTVQHGYNLRSGNEKIIGPQANTYRFARVVHKAPC 129 >SB_51848| Best HMM Match : DUF1135 (HMM E-Value=6.4e-09) Length = 498 Score = 27.9 bits (59), Expect = 9.0 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = +3 Query: 381 ELAVQFVVHLLHKYWQLPCLV 443 +L + F+ HLLH +Q+PC + Sbjct: 272 QLLIVFIKHLLHDRFQVPCTI 292 >SB_207| Best HMM Match : RVT_1 (HMM E-Value=7.4e-06) Length = 773 Score = 23.0 bits (47), Expect(2) = 9.7 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = -2 Query: 441 PDKGVANICAADEPQIVQPIPHMLERNV 358 P G ++C A +VQP H L + + Sbjct: 8 PSVGRFSVCVAQSQIVVQPKHHELTKRI 35 Score = 23.0 bits (47), Expect(2) = 9.7 Identities = 10/33 (30%), Positives = 16/33 (48%), Gaps = 3/33 (9%) Frame = -2 Query: 366 RNVP---TMMSTAHAWQTILHGVQVLVSYMLML 277 +N+P T T H WQ++L + + Y L Sbjct: 59 KNIPLIATRSITTHLWQSLLRAILLAFKYFCEL 91 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,584,249 Number of Sequences: 59808 Number of extensions: 543444 Number of successful extensions: 1412 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1280 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1411 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1974037988 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -