BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11f03f (608 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 23 2.7 AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein p... 23 2.7 AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein p... 23 2.7 AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 22 4.6 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 6.1 AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory recept... 21 8.1 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 22.6 bits (46), Expect = 2.7 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -1 Query: 266 HGVHAQHGPYP 234 +G H+QHG YP Sbjct: 8 YGHHSQHGTYP 18 >AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein protein. Length = 210 Score = 22.6 bits (46), Expect = 2.7 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -1 Query: 266 HGVHAQHGPYP 234 +G H+QHG YP Sbjct: 8 YGHHSQHGTYP 18 >AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein protein. Length = 253 Score = 22.6 bits (46), Expect = 2.7 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -1 Query: 266 HGVHAQHGPYP 234 +G H+QHG YP Sbjct: 8 YGHHSQHGTYP 18 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 21.8 bits (44), Expect = 4.6 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +3 Query: 180 SAPT*PRTRWTNIMNTTIWIWAMLGMNTM 266 S+PT +TN N++IW A + T+ Sbjct: 201 SSPTIASATYTNSANSSIWSPASIDSFTL 229 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.4 bits (43), Expect = 6.1 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +2 Query: 515 IFIIALLYEGLKYYRKHLLWKTYAGLQYCA 604 IFII ++ + + HLL+ G+ Y A Sbjct: 615 IFIICVIVQSEQIAWLHLLYIFLVGIMYAA 644 >AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory receptor candidate 1 protein. Length = 373 Score = 21.0 bits (42), Expect = 8.1 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +2 Query: 515 IFIIALLYEGLKYYRKHLLWKTYAGLQYCA 604 IF+I +L + K HL++ ++ G+ CA Sbjct: 259 IFVICVLVQSEKIVWLHLVYISFLGI-ICA 287 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,965 Number of Sequences: 336 Number of extensions: 3905 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15457268 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -