BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11e24f (623 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1D4.14 |tho2|SPAC22F3.14c|THO complex subunit Tho2 |Schizosa... 27 2.2 SPAC6F6.13c |||DUF726 family protein|Schizosaccharomyces pombe|c... 27 2.9 SPAC15A10.04c |zpr1||zinc finger protein Zpr1|Schizosaccharomyce... 26 3.8 SPAC607.08c |||DUF726 family protein|Schizosaccharomyces pombe|c... 26 3.8 SPBC13A2.04c |||PTR family peptide transporter|Schizosaccharomyc... 26 5.1 SPCC1020.13c ||SPCC14G10.05|phospholipase |Schizosaccharomyces p... 26 5.1 SPCC1223.02 |nmt1|thi3|no message in thiamine Nmt1|Schizosacchar... 26 5.1 >SPAC1D4.14 |tho2|SPAC22F3.14c|THO complex subunit Tho2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1628 Score = 27.1 bits (57), Expect = 2.2 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -1 Query: 596 NPRSIFSRLINGDPMFDSVTEIRVDHARVV 507 NP ++FS +N +D++ E+ VD AR + Sbjct: 670 NPCTVFSIALNQIETYDNLVEVVVDSARFI 699 >SPAC6F6.13c |||DUF726 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 778 Score = 26.6 bits (56), Expect = 2.9 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 604 RAVTLVAYSLGSLMVIQCL 548 R VTLV YSLG+ ++ CL Sbjct: 568 RPVTLVGYSLGARVIYYCL 586 >SPAC15A10.04c |zpr1||zinc finger protein Zpr1|Schizosaccharomyces pombe|chr 1|||Manual Length = 459 Score = 26.2 bits (55), Expect = 3.8 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = -2 Query: 508 SSNQMEASGLAKPPSSCSF*GKSQWNKVIIGVMPYF 401 ++ E +G+ + S C GK+ K+++ V+PYF Sbjct: 22 TAEDREGNGVQEVESLCMECGKNGTTKLLLTVIPYF 57 >SPAC607.08c |||DUF726 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 579 Score = 26.2 bits (55), Expect = 3.8 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = -2 Query: 604 RAVTLVAYSLGSLMVIQCL 548 R VTL+ +SLG+ +++CL Sbjct: 389 RPVTLIGFSLGARTILECL 407 >SPBC13A2.04c |||PTR family peptide transporter|Schizosaccharomyces pombe|chr 2|||Manual Length = 618 Score = 25.8 bits (54), Expect = 5.1 Identities = 11/40 (27%), Positives = 20/40 (50%) Frame = +1 Query: 448 LRSCRNWEASPIHWLPFGLKTTRAWSTRISVTESNIGSPL 567 LR+C+ + PI+W+ +G T S + N+ + L Sbjct: 357 LRACKTFLFYPIYWVCYGQMTNNLISQAGQMQTGNVSNDL 396 >SPCC1020.13c ||SPCC14G10.05|phospholipase |Schizosaccharomyces pombe|chr 3|||Manual Length = 669 Score = 25.8 bits (54), Expect = 5.1 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -2 Query: 598 VTLVAYSLGSLMVIQCLTLSPKFV 527 + ++ +SLGS +V L+L P FV Sbjct: 394 IFIIGHSLGSTVVFDILSLQPTFV 417 >SPCC1223.02 |nmt1|thi3|no message in thiamine Nmt1|Schizosaccharomyces pombe|chr 3|||Manual Length = 346 Score = 25.8 bits (54), Expect = 5.1 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +1 Query: 463 NWEASPIHWLPFGLKTTRAWSTR 531 NWEA+P H LP L TR + R Sbjct: 11 NWEATPYH-LPIFLAQTRGYYER 32 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,405,879 Number of Sequences: 5004 Number of extensions: 44961 Number of successful extensions: 143 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 136 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 143 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 275671126 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -