BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11e21r (701 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0811 - 19909128-19912214 29 2.7 12_02_0304 + 17112677-17113195 29 3.6 12_02_0367 - 18053979-18054618,18055844-18055988,18056049-18056649 29 4.7 07_03_0951 - 22836167-22836358,22836455-22837213 29 4.7 03_01_0014 + 113638-113754,113836-113950,114570-114835,115365-11... 29 4.7 02_02_0549 + 11410129-11412180 29 4.7 03_06_0203 - 32337928-32338025,32338745-32338820,32338905-323389... 28 6.2 08_02_1480 + 27401923-27402158,27402847-27402982,27403119-274031... 28 8.3 01_07_0385 - 43212580-43213142,43213234-43213612 28 8.3 >04_03_0811 - 19909128-19912214 Length = 1028 Score = 29.5 bits (63), Expect = 2.7 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = +2 Query: 596 GCWSVRKLRRLKFCHS*VRSQVQQDGGEHXRWR 694 GCWS+R+L L+ HS SQ + GE WR Sbjct: 962 GCWSLRRLPLLRQEHS---SQAVEVSGERAWWR 991 >12_02_0304 + 17112677-17113195 Length = 172 Score = 29.1 bits (62), Expect = 3.6 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -2 Query: 556 PRLVSSPSLLAQLTSSPEAPGSPPPV 479 PR SPS+ A+ T +P SPPPV Sbjct: 42 PRRAPSPSVTAEPTPAPVIAPSPPPV 67 >12_02_0367 - 18053979-18054618,18055844-18055988,18056049-18056649 Length = 461 Score = 28.7 bits (61), Expect = 4.7 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -1 Query: 623 CGASLLTNTRSVTAAHCWRSR 561 CG+ ++T TRSVT A C S+ Sbjct: 275 CGSRIITTTRSVTVASCCSSQ 295 >07_03_0951 - 22836167-22836358,22836455-22837213 Length = 316 Score = 28.7 bits (61), Expect = 4.7 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = -3 Query: 297 SQQPTKTPSQPSGHY*RRLRPDFWK 223 S PT TPSQPS Y RR R + W+ Sbjct: 63 SPPPTPTPSQPSSSYHRR-RRESWE 86 >03_01_0014 + 113638-113754,113836-113950,114570-114835,115365-115575, 115915-115979,118723-118930,119457-119566,119663-119913, 120250-120356,120442-120509,120624-120701,121070-121198, 121341-121481,122297-122344,122648-122743,124071-124183, 124441-124591,124745-124818,124913-125072,125356-125454, 125532-125618,125761-125907 Length = 946 Score = 28.7 bits (61), Expect = 4.7 Identities = 11/39 (28%), Positives = 15/39 (38%) Frame = +2 Query: 275 GVFVGCWLPKQHRKFCRSRQPRPKYQQSCCFHWLG*CAE 391 G + G + + RK+ P CC HW C E Sbjct: 149 GTYTGIFRQELQRKYHLKNSPCDPCMVHCCLHWCANCQE 187 >02_02_0549 + 11410129-11412180 Length = 683 Score = 28.7 bits (61), Expect = 4.7 Identities = 21/61 (34%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Frame = -1 Query: 536 LAFGTANIFSGGTRVTTSSVHMHGSYNMNNLHN-DVAVINHNHVGFNNNIQRINLASGSN 360 LA +F+G V ++S H+ + ++ + N D IN+NHVG N N +LAS N Sbjct: 129 LANNYMGLFNGTGSVGSASNHLF-AVELDTIQNPDFRDINNNHVGININ----DLASRDN 183 Query: 359 N 357 + Sbjct: 184 D 184 >03_06_0203 - 32337928-32338025,32338745-32338820,32338905-32338971, 32339181-32339275,32340062-32340151,32340293-32340340, 32340764-32341069 Length = 259 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -2 Query: 556 PRLVSSPSLLAQLTSSPEAPGSPPP 482 PRLVSSP+ L + P+ P P P Sbjct: 49 PRLVSSPAKLTDDATPPQPPPQPQP 73 >08_02_1480 + 27401923-27402158,27402847-27402982,27403119-27403168, 27403810-27403813,27404394-27404494,27405084-27406305 Length = 582 Score = 27.9 bits (59), Expect = 8.3 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -2 Query: 544 SSPSLLAQLTSSPEAPGSPPP 482 SS S + +SSP AP SPPP Sbjct: 7 SSTSSSSSASSSPRAPSSPPP 27 >01_07_0385 - 43212580-43213142,43213234-43213612 Length = 313 Score = 27.9 bits (59), Expect = 8.3 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = +3 Query: 483 GGGDPGASGEDVSCAKSEGELTSLGIPGPP--AVSSGHR 593 GGGD GAS VS A + +G+ PP V +G R Sbjct: 182 GGGDGGASSVVVSAAAAAARRLPVGVRKPPLHVVVTGER 220 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,600,931 Number of Sequences: 37544 Number of extensions: 325679 Number of successful extensions: 1340 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1281 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1339 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1803843684 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -