BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11e17r (344 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 22 2.3 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 22 2.3 DQ435332-1|ABD92647.1| 135|Apis mellifera OBP15 protein. 20 9.5 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 21.8 bits (44), Expect = 2.3 Identities = 7/34 (20%), Positives = 19/34 (55%) Frame = +3 Query: 219 YTFNEKNYHKSL*PRHFSFKGENIFYNRMKITRL 320 Y +N NY+ + +++ + ++YN + I ++ Sbjct: 331 YNYNNNNYNNNNYNNNYNNNCKKLYYNIINIEQI 364 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 21.8 bits (44), Expect = 2.3 Identities = 9/29 (31%), Positives = 12/29 (41%) Frame = -3 Query: 120 RQIGQNKEEP*ECQVQGSMLKVPVHPGHH 34 R G+ E+P C + G VP H Sbjct: 82 RSHGKEGEDPYRCNICGKTFAVPARLTRH 110 >DQ435332-1|ABD92647.1| 135|Apis mellifera OBP15 protein. Length = 135 Score = 19.8 bits (39), Expect = 9.5 Identities = 9/31 (29%), Positives = 14/31 (45%) Frame = -1 Query: 122 DAKSVKIKKNPENVKFKVRCSRFLYTLVITD 30 D KI ENV+ + C+ ++ V D Sbjct: 46 DVNDGKINIEDENVQLYIECAMKKFSFVDKD 76 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 87,957 Number of Sequences: 438 Number of extensions: 1531 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 7812315 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -