BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11e17f (411 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_06_0013 + 24852262-24852264,24852717-24852900,24853449-24853471 104 3e-23 11_04_0100 + 13465369-13465371,13465464-13465647,13466506-13466528 102 1e-22 07_03_0802 - 21614891-21615195,21615637-21615823,21615939-216161... 100 4e-22 05_01_0178 - 1235546-1235756,1235869-1235945,1236194-1236347,123... 27 7.7 01_01_0066 - 513578-513730,513809-513920,514000-514163,514369-51... 27 7.7 >05_06_0013 + 24852262-24852264,24852717-24852900,24853449-24853471 Length = 69 Score = 104 bits (249), Expect = 3e-23 Identities = 47/69 (68%), Positives = 60/69 (86%) Frame = +1 Query: 169 MPREIKDIKDFLIKARRKDAKSVKIKKNPENVKFKVRCSRFLYTLVITDKEKAEKLKQSL 348 MP++I +IKDFL+ ARRKDA+SV+IK++ + VKFKVRCSR+LYTL + D +KA KLKQSL Sbjct: 1 MPKQIHEIKDFLLTARRKDARSVRIKRSKDAVKFKVRCSRYLYTLCVHDTDKANKLKQSL 60 Query: 349 PPGLQVKEV 375 PPGL V+EV Sbjct: 61 PPGLTVQEV 69 >11_04_0100 + 13465369-13465371,13465464-13465647,13466506-13466528 Length = 69 Score = 102 bits (245), Expect = 1e-22 Identities = 46/69 (66%), Positives = 59/69 (85%) Frame = +1 Query: 169 MPREIKDIKDFLIKARRKDAKSVKIKKNPENVKFKVRCSRFLYTLVITDKEKAEKLKQSL 348 MP++I +IKDFL+ ARRKDA+SV+IK+ + VKFKVRCS++LYTL + D +KA KLKQSL Sbjct: 1 MPKQIHEIKDFLLTARRKDARSVRIKRTKDAVKFKVRCSKYLYTLCVFDADKANKLKQSL 60 Query: 349 PPGLQVKEV 375 PPGL V+EV Sbjct: 61 PPGLTVQEV 69 >07_03_0802 - 21614891-21615195,21615637-21615823,21615939-21616154, 21616669-21616872,21617336-21617569,21617670-21617763, 21618844-21618890,21619293-21619309,21620183-21620459 Length = 526 Score = 100 bits (240), Expect = 4e-22 Identities = 45/68 (66%), Positives = 58/68 (85%) Frame = +1 Query: 172 PREIKDIKDFLIKARRKDAKSVKIKKNPENVKFKVRCSRFLYTLVITDKEKAEKLKQSLP 351 P++I +IKDFL+ ARRKDA+SV+IK+ + VKFKVRCS++LYTL + D +KA KLKQSLP Sbjct: 32 PKQIHEIKDFLLTARRKDARSVRIKRTKDAVKFKVRCSKYLYTLCVFDADKANKLKQSLP 91 Query: 352 PGLQVKEV 375 PGL V+EV Sbjct: 92 PGLTVQEV 99 >05_01_0178 - 1235546-1235756,1235869-1235945,1236194-1236347, 1237067-1237216,1237363-1237484,1237806-1237910, 1237986-1238213 Length = 348 Score = 26.6 bits (56), Expect = 7.7 Identities = 12/54 (22%), Positives = 28/54 (51%) Frame = +1 Query: 169 MPREIKDIKDFLIKARRKDAKSVKIKKNPENVKFKVRCSRFLYTLVITDKEKAE 330 MP + + L+ + + +V ++ N + +V C ++L+ +I++K AE Sbjct: 170 MPPDGISVHPILVDTKTRYKPTVPLEAQKRNGRLQVMCYKYLWDNLISEKFPAE 223 >01_01_0066 - 513578-513730,513809-513920,514000-514163,514369-514521, 514598-514736,514823-514923,514995-515666,515953-516038, 516112-516777,516874-517128,517231-517358,518645-518799, 518880-519133,519186-519260,519324-519399,519511-519644, 519871-520153,520692-520850,520940-521038,521142-521310, 521423-521653,522002-522114,524179-524310,524389-524469, 525641-525763 Length = 1570 Score = 26.6 bits (56), Expect = 7.7 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = -1 Query: 132 EIYTFNEKNYHKSL*PRHFSFKGENI--FYNRMKITRLNRIN 13 EIY KNYHKSL R F FK ++ + +T + IN Sbjct: 794 EIYA---KNYHKSLDHRSFYFKQQDTKNLSTKSLLTEIKEIN 832 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,295,628 Number of Sequences: 37544 Number of extensions: 160768 Number of successful extensions: 346 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 342 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 346 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 730630428 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -