BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11e17f (411 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41824| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.0 SB_3867| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.5 SB_37158| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.5 SB_52212| Best HMM Match : Rho_N (HMM E-Value=5.2e-05) 27 6.0 SB_47804| Best HMM Match : E-MAP-115 (HMM E-Value=1.4) 27 6.0 SB_35518| Best HMM Match : Peptidase_A17 (HMM E-Value=1.3e-09) 27 6.0 SB_18379| Best HMM Match : Rho_N (HMM E-Value=5.2e-05) 27 6.0 SB_15824| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.0 SB_46327| Best HMM Match : Rho_N (HMM E-Value=4.2e-05) 27 6.0 SB_19314| Best HMM Match : Rho_N (HMM E-Value=5.2e-05) 27 6.0 SB_5092| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.0 SB_24778| Best HMM Match : DUF1409 (HMM E-Value=4.2) 27 7.9 >SB_41824| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 451 Score = 28.7 bits (61), Expect = 2.0 Identities = 22/67 (32%), Positives = 36/67 (53%), Gaps = 2/67 (2%) Frame = +1 Query: 178 EIKDIKDFLIKARRKDAKSVKIKKNPENVKFK-VRCSRF-LYTLVITDKEKAEKLKQSLP 351 E ++ KDFL A R KSVK K+ + + ++ +R+ L T+ DK+ E++ + Sbjct: 37 EKEEEKDFLHSAERNSLKSVKPKEEAKELVIPLMKKNRWILPTVEGLDKQAMEEVIKEAQ 96 Query: 352 PGLQVKE 372 LQ KE Sbjct: 97 KDLQSKE 103 >SB_3867| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 27.5 bits (58), Expect = 4.5 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +1 Query: 307 ITDKEKAEKLKQSLPPGLQVKEV 375 I + E+ EK+KQ PGL VK++ Sbjct: 134 ILENERREKIKQFTEPGLTVKKI 156 >SB_37158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1421 Score = 27.5 bits (58), Expect = 4.5 Identities = 17/69 (24%), Positives = 36/69 (52%), Gaps = 1/69 (1%) Frame = +1 Query: 172 PREIKDIKDFLIKARRK-DAKSVKIKKNPENVKFKVRCSRFLYTLVITDKEKAEKLKQSL 348 P+ +D+ + L++ RR A + IKK PE++ ++ + L T + + + S+ Sbjct: 731 PKLQQDLFNVLVRFRRNLVALACDIKKMPEDINMNIQWQQIETVLKSTYMDDSIDIVASV 790 Query: 349 PPGLQVKEV 375 G+++ EV Sbjct: 791 EEGIELYEV 799 >SB_52212| Best HMM Match : Rho_N (HMM E-Value=5.2e-05) Length = 384 Score = 27.1 bits (57), Expect = 6.0 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +1 Query: 193 KDFLIKARRKDAKSVKIKKNPENVKFKVRC 282 K+F+ K R K K V +K P VKF C Sbjct: 191 KEFITKIRPKVIKLVNDRKKPIKVKFVFTC 220 >SB_47804| Best HMM Match : E-MAP-115 (HMM E-Value=1.4) Length = 402 Score = 27.1 bits (57), Expect = 6.0 Identities = 19/59 (32%), Positives = 31/59 (52%) Frame = +1 Query: 154 LFVFNMPREIKDIKDFLIKARRKDAKSVKIKKNPENVKFKVRCSRFLYTLVITDKEKAE 330 L V ++ E+ LI A+R AKS ++K PE F +C+ Y L++ K+ A+ Sbjct: 137 LGVSDVDAELLKTARSLISAQRAGAKS-EVK--PEMSAFVSKCNAAAYDLILDGKQTAD 192 >SB_35518| Best HMM Match : Peptidase_A17 (HMM E-Value=1.3e-09) Length = 385 Score = 27.1 bits (57), Expect = 6.0 Identities = 21/69 (30%), Positives = 36/69 (52%) Frame = -1 Query: 318 FVSDDQGVQEP*ASNLELDILRVLLYFDRFGVFPPRLN*KVFDIFDFTRHVEDE*FSTST 139 F+S + +QE NL D LY R+ + RLN ++ + F R+++ + F Sbjct: 258 FISGKKILQELCKENLGWDDEVSDLYRVRWEKW--RLNLQLLEKFSMDRYLKPQDFGPVM 315 Query: 138 VREIYTFNE 112 VREI+ F++ Sbjct: 316 VREIHNFSD 324 >SB_18379| Best HMM Match : Rho_N (HMM E-Value=5.2e-05) Length = 398 Score = 27.1 bits (57), Expect = 6.0 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +1 Query: 193 KDFLIKARRKDAKSVKIKKNPENVKFKVRC 282 K+F+ K R K K V +K P VKF C Sbjct: 359 KEFITKIRPKVIKLVNDRKKPIKVKFVFTC 388 >SB_15824| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1258 Score = 27.1 bits (57), Expect = 6.0 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +1 Query: 193 KDFLIKARRKDAKSVKIKKNPENVKFKVRC 282 K+F+ K R K K V +K P VKF C Sbjct: 239 KEFITKIRPKVIKLVNDRKKPIKVKFVFTC 268 >SB_46327| Best HMM Match : Rho_N (HMM E-Value=4.2e-05) Length = 856 Score = 27.1 bits (57), Expect = 6.0 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +1 Query: 193 KDFLIKARRKDAKSVKIKKNPENVKFKVRC 282 K+F+ K R K K V +K P VKF C Sbjct: 239 KEFITKIRPKVIKLVNDRKKPIKVKFVFTC 268 >SB_19314| Best HMM Match : Rho_N (HMM E-Value=5.2e-05) Length = 708 Score = 27.1 bits (57), Expect = 6.0 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +1 Query: 193 KDFLIKARRKDAKSVKIKKNPENVKFKVRC 282 K+F+ K R K K V +K P VKF C Sbjct: 239 KEFITKIRPKVIKLVNDRKKPIKVKFVFTC 268 >SB_5092| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 27.1 bits (57), Expect = 6.0 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -2 Query: 311 VMTRVYRNLEHRTLNLTFSGFFFILT 234 VM R + RT++LTFS F +LT Sbjct: 198 VMARTVSQITTRTISLTFSRFMVLLT 223 >SB_24778| Best HMM Match : DUF1409 (HMM E-Value=4.2) Length = 74 Score = 26.6 bits (56), Expect = 7.9 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = +1 Query: 184 KDIKDFLIKARRKDAKSVKIKKNPENVKFKVRCSRF-LYTLVITDKEKAE 330 KD+KD K + + VK KKN + V+ ++ ++ L ++IT K K E Sbjct: 25 KDLKDVQEKHKTDKEELVKCKKNIKTVEQELATTKHQLNEMLITVKTKIE 74 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,111,755 Number of Sequences: 59808 Number of extensions: 205067 Number of successful extensions: 458 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 421 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 458 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 752487277 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -