BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11e17f (411 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g59540.1 68416.m06645 60S ribosomal protein L38 (RPL38B) 60S ... 105 9e-24 At2g43460.1 68415.m05401 60S ribosomal protein L38 (RPL38A) 105 9e-24 At1g75930.1 68414.m08819 family II extracellular lipase 6 (EXL6)... 28 2.1 At5g05200.1 68418.m00554 ABC1 family protein contains Pfam domai... 27 3.7 At2g39260.1 68415.m04821 MIF4G domain-containing protein similar... 27 6.5 At2g31900.1 68415.m03897 myosin family protein contains Pfam pro... 26 8.6 At1g78880.1 68414.m09195 balbiani ring 1-related / BR1-related c... 26 8.6 >At3g59540.1 68416.m06645 60S ribosomal protein L38 (RPL38B) 60S RIBOSOMAL PROTEIN L38 - Lycopersicon esculentum, EMBL:X69979 Length = 69 Score = 105 bits (253), Expect = 9e-24 Identities = 47/69 (68%), Positives = 62/69 (89%) Frame = +1 Query: 169 MPREIKDIKDFLIKARRKDAKSVKIKKNPENVKFKVRCSRFLYTLVITDKEKAEKLKQSL 348 MP++I +IKDFL+ ARRKDA+SVKIK++ + VKFKVRCSR+LYTL + D+EKA+KLKQSL Sbjct: 1 MPKQIHEIKDFLLTARRKDARSVKIKRSKDIVKFKVRCSRYLYTLCVFDQEKADKLKQSL 60 Query: 349 PPGLQVKEV 375 PPGL V+++ Sbjct: 61 PPGLSVQDL 69 >At2g43460.1 68415.m05401 60S ribosomal protein L38 (RPL38A) Length = 69 Score = 105 bits (253), Expect = 9e-24 Identities = 47/69 (68%), Positives = 62/69 (89%) Frame = +1 Query: 169 MPREIKDIKDFLIKARRKDAKSVKIKKNPENVKFKVRCSRFLYTLVITDKEKAEKLKQSL 348 MP++I +IKDFL+ ARRKDA+SVKIK++ + VKFKVRCSR+LYTL + D+EKA+KLKQSL Sbjct: 1 MPKQIHEIKDFLLTARRKDARSVKIKRSKDIVKFKVRCSRYLYTLCVFDQEKADKLKQSL 60 Query: 349 PPGLQVKEV 375 PPGL V+++ Sbjct: 61 PPGLSVQDL 69 >At1g75930.1 68414.m08819 family II extracellular lipase 6 (EXL6) EXL6 (PMID:11431566); similar to anter-specific proline-rich protein (APG) SP:P40602 [Arabidopsis thaliana] Length = 343 Score = 28.3 bits (60), Expect = 2.1 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +1 Query: 154 LFVFNMPREIKDIKDFLIKARRKDAKSVKIKKNPENVKFKV 276 L V + ++KD KD+L K RR + K+K+ N F + Sbjct: 125 LRVLSAGDQVKDFKDYLKKLRRVVKRKKKVKEIVSNAVFLI 165 >At5g05200.1 68418.m00554 ABC1 family protein contains Pfam domain, PF03109: ABC1 family Length = 540 Score = 27.5 bits (58), Expect = 3.7 Identities = 18/44 (40%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Frame = -1 Query: 333 FLSLLFVSDDQGVQEP*ASNLELDILRVLLYFDRF-GVFPPRLN 205 FL L+ VS+ G++ P L +L+ LLYFDR+ + P LN Sbjct: 477 FLDLVRVSESYGLKFPREFAL---LLKQLLYFDRYTRLLAPNLN 517 >At2g39260.1 68415.m04821 MIF4G domain-containing protein similar to hUPF2 [Homo sapiens] GI:12232320; contains Pfam profile PF02854: MIF4G domain Length = 1186 Score = 26.6 bits (56), Expect = 6.5 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +1 Query: 181 IKDIKDFLIKARRKDAKSVKIKKNPENVKFKVRCSRFL 294 +KDI L++ + S+ KK+ N++ K+R RF+ Sbjct: 531 MKDIPSMLVQMLEDEFNSLVHKKDQMNIETKIRNIRFI 568 >At2g31900.1 68415.m03897 myosin family protein contains Pfam profiles: PF00063 myosin head (motor domain), PF01843 DIL domain, PF00612 IQ calmodulin-binding motif, PF02736 myosin N-terminal SH3-like domain Length = 1556 Score = 26.2 bits (55), Expect = 8.6 Identities = 19/56 (33%), Positives = 27/56 (48%) Frame = +1 Query: 208 KARRKDAKSVKIKKNPENVKFKVRCSRFLYTLVITDKEKAEKLKQSLPPGLQVKEV 375 KA +DAK+ +I K N+ Y +I DKE A+ + PP +KEV Sbjct: 911 KADLEDAKAQEIAKLQNNLTELQEKLDEAYAAIIRDKEAAKLAIEQAPP--IIKEV 964 >At1g78880.1 68414.m09195 balbiani ring 1-related / BR1-related contains weak similarity to BR1 [Chironomus tentans] gi|7042|emb|CAA45607 Length = 468 Score = 26.2 bits (55), Expect = 8.6 Identities = 20/55 (36%), Positives = 31/55 (56%) Frame = +1 Query: 103 IIFFVKSVYFSYSAG*KLFVFNMPREIKDIKDFLIKARRKDAKSVKIKKNPENVK 267 I+ V +V F+ A LF++N+ E + I DF+ AR DA ++ KN + VK Sbjct: 230 ILLIVVAVLFTVVAA--LFIWNISCERRGITDFI--ARYPDA-DLRTAKNGQYVK 279 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,032,794 Number of Sequences: 28952 Number of extensions: 148978 Number of successful extensions: 381 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 377 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 381 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 615542944 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -