BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11e16r (687 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP35G2.11c |||transcription related zf-ZZ type zinc finger pro... 27 3.4 SPAC1F5.07c |hem14||protoporphyrinogen oxidase|Schizosaccharomyc... 26 5.9 >SPBP35G2.11c |||transcription related zf-ZZ type zinc finger protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 397 Score = 26.6 bits (56), Expect = 3.4 Identities = 14/35 (40%), Positives = 17/35 (48%), Gaps = 7/35 (20%) Frame = +3 Query: 480 NXTFHCDKTFDFFKNPDYYS-------CPSPRRIL 563 N +FHC K FDF D Y+ CP P +L Sbjct: 71 NDSFHCTKCFDFDVCRDCYAKQAFLHPCPKPHFVL 105 >SPAC1F5.07c |hem14||protoporphyrinogen oxidase|Schizosaccharomyces pombe|chr 1|||Manual Length = 490 Score = 25.8 bits (54), Expect = 5.9 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -3 Query: 592 PRCILDLYESSMRLG 548 P+C +DLYE RLG Sbjct: 24 PKCTIDLYEKGPRLG 38 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,601,975 Number of Sequences: 5004 Number of extensions: 50113 Number of successful extensions: 91 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 88 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 91 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 317927284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -