BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11e16f (636 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-b... 26 0.87 EF519384-1|ABP68493.1| 506|Anopheles gambiae LRIM1 protein. 25 1.5 EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. 25 1.5 EF519382-1|ABP68491.1| 493|Anopheles gambiae LRIM1 protein. 25 1.5 EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. 25 1.5 EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. 25 1.5 EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. 25 1.5 EF519375-1|ABP68484.1| 493|Anopheles gambiae LRIM1 protein. 25 1.5 EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. 25 1.5 EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. 25 1.5 EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. 25 1.5 EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. 25 1.5 EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. 25 1.5 EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. 25 1.5 EF519368-1|ABP68477.1| 506|Anopheles gambiae LRIM1 protein. 25 1.5 EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. 25 1.5 EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. 25 1.5 EF519365-1|ABP68474.1| 486|Anopheles gambiae LRIM1 protein. 25 1.5 EF519364-1|ABP68473.1| 496|Anopheles gambiae LRIM1 protein. 25 1.5 EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. 25 1.5 EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. 25 1.5 EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. 25 1.5 EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. 25 1.5 EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. 25 1.5 EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. 25 1.5 EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. 25 1.5 EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. 25 1.5 EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. 25 1.5 EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. 25 1.5 EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. 25 1.5 EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. 25 1.5 EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. 25 1.5 EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. 25 1.5 EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. 25 1.5 EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. 25 1.5 EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. 25 1.5 AY344814-1|AAR03842.1| 286|Anopheles gambiae LRR Toll protein. 25 1.5 AY344813-1|AAR03841.1| 286|Anopheles gambiae LRR Toll protein. 25 1.5 AY344812-1|AAR03840.1| 286|Anopheles gambiae LRR Toll protein. 25 1.5 AY344811-1|AAR03839.1| 286|Anopheles gambiae LRR Toll protein. 25 1.5 AY344810-1|AAR03838.1| 286|Anopheles gambiae LRR Toll protein. 25 1.5 AY344809-1|AAR03837.1| 286|Anopheles gambiae LRR Toll protein. 25 1.5 AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CY... 24 3.5 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 4.6 >AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-binding protein OBPjj17 protein. Length = 285 Score = 26.2 bits (55), Expect = 0.87 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +1 Query: 208 RRGD*YKKSTKANRNGNG 261 +RG Y + T+ NRNGNG Sbjct: 257 QRGGNYPRGTERNRNGNG 274 >EF519384-1|ABP68493.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +2 Query: 530 GFKWKKIQNNKQILIERTDIRF-QRIEY 610 G W ++NNK +LIE+ +RF Q +E+ Sbjct: 237 GVTWISLRNNKLVLIEKA-LRFSQNLEH 263 >EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +2 Query: 530 GFKWKKIQNNKQILIERTDIRF-QRIEY 610 G W ++NNK +LIE+ +RF Q +E+ Sbjct: 237 GVTWISLRNNKLVLIEKA-LRFSQNLEH 263 >EF519382-1|ABP68491.1| 493|Anopheles gambiae LRIM1 protein. Length = 493 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +2 Query: 530 GFKWKKIQNNKQILIERTDIRF-QRIEY 610 G W ++NNK +LIE+ +RF Q +E+ Sbjct: 237 GVTWISLRNNKLVLIEKA-LRFSQNLEH 263 >EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +2 Query: 530 GFKWKKIQNNKQILIERTDIRF-QRIEY 610 G W ++NNK +LIE+ +RF Q +E+ Sbjct: 237 GVTWISLRNNKLVLIEKA-LRFSQNLEH 263 >EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +2 Query: 530 GFKWKKIQNNKQILIERTDIRF-QRIEY 610 G W ++NNK +LIE+ +RF Q +E+ Sbjct: 237 GVTWISLRNNKLVLIEKA-LRFSQNLEH 263 >EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +2 Query: 530 GFKWKKIQNNKQILIERTDIRF-QRIEY 610 G W ++NNK +LIE+ +RF Q +E+ Sbjct: 237 GVTWISLRNNKLVLIEKA-LRFSQNLEH 263 >EF519375-1|ABP68484.1| 493|Anopheles gambiae LRIM1 protein. Length = 493 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +2 Query: 530 GFKWKKIQNNKQILIERTDIRF-QRIEY 610 G W ++NNK +LIE+ +RF Q +E+ Sbjct: 237 GVTWISLRNNKLVLIEKA-LRFSQNLEH 263 >EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +2 Query: 530 GFKWKKIQNNKQILIERTDIRF-QRIEY 610 G W ++NNK +LIE+ +RF Q +E+ Sbjct: 237 GVTWISLRNNKLVLIEKA-LRFSQNLEH 263 >EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +2 Query: 530 GFKWKKIQNNKQILIERTDIRF-QRIEY 610 G W ++NNK +LIE+ +RF Q +E+ Sbjct: 237 GVTWISLRNNKLVLIEKA-LRFSQNLEH 263 >EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +2 Query: 530 GFKWKKIQNNKQILIERTDIRF-QRIEY 610 G W ++NNK +LIE+ +RF Q +E+ Sbjct: 237 GVTWISLRNNKLVLIEKA-LRFSQNLEH 263 >EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +2 Query: 530 GFKWKKIQNNKQILIERTDIRF-QRIEY 610 G W ++NNK +LIE+ +RF Q +E+ Sbjct: 237 GVTWISLRNNKLVLIEKA-LRFSQNLEH 263 >EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. Length = 452 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +2 Query: 530 GFKWKKIQNNKQILIERTDIRF-QRIEY 610 G W ++NNK +LIE+ +RF Q +E+ Sbjct: 222 GVTWISLRNNKLVLIEKA-LRFSQNLEH 248 >EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +2 Query: 530 GFKWKKIQNNKQILIERTDIRF-QRIEY 610 G W ++NNK +LIE+ +RF Q +E+ Sbjct: 237 GVTWISLRNNKLVLIEKA-LRFSQNLEH 263 >EF519368-1|ABP68477.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +2 Query: 530 GFKWKKIQNNKQILIERTDIRF-QRIEY 610 G W ++NNK +LIE+ +RF Q +E+ Sbjct: 237 GVTWISLRNNKLVLIEKA-LRFSQNLEH 263 >EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +2 Query: 530 GFKWKKIQNNKQILIERTDIRF-QRIEY 610 G W ++NNK +LIE+ +RF Q +E+ Sbjct: 237 GVTWISLRNNKLVLIEKA-LRFSQNLEH 263 >EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +2 Query: 530 GFKWKKIQNNKQILIERTDIRF-QRIEY 610 G W ++NNK +LIE+ +RF Q +E+ Sbjct: 237 GVTWISLRNNKLVLIEKA-LRFSQNLEH 263 >EF519365-1|ABP68474.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +2 Query: 530 GFKWKKIQNNKQILIERTDIRF-QRIEY 610 G W ++NNK +LIE+ +RF Q +E+ Sbjct: 237 GVTWISLRNNKLVLIEKA-LRFSQNLEH 263 >EF519364-1|ABP68473.1| 496|Anopheles gambiae LRIM1 protein. Length = 496 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +2 Query: 530 GFKWKKIQNNKQILIERTDIRF-QRIEY 610 G W ++NNK +LIE+ +RF Q +E+ Sbjct: 237 GVTWISLRNNKLVLIEKA-LRFSQNLEH 263 >EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +2 Query: 530 GFKWKKIQNNKQILIERTDIRF-QRIEY 610 G W ++NNK +LIE+ +RF Q +E+ Sbjct: 237 GVTWISLRNNKLVLIEKA-LRFSQNLEH 263 >EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +2 Query: 530 GFKWKKIQNNKQILIERTDIRF-QRIEY 610 G W ++NNK +LIE+ +RF Q +E+ Sbjct: 237 GVTWISLRNNKLVLIEKA-LRFSQNLEH 263 >EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +2 Query: 530 GFKWKKIQNNKQILIERTDIRF-QRIEY 610 G W ++NNK +LIE+ +RF Q +E+ Sbjct: 237 GVTWISLRNNKLVLIEKA-LRFSQNLEH 263 >EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. Length = 499 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +2 Query: 530 GFKWKKIQNNKQILIERTDIRF-QRIEY 610 G W ++NNK +LIE+ +RF Q +E+ Sbjct: 237 GVTWISLRNNKLVLIEKA-LRFSQNLEH 263 >EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +2 Query: 530 GFKWKKIQNNKQILIERTDIRF-QRIEY 610 G W ++NNK +LIE+ +RF Q +E+ Sbjct: 237 GVTWISLRNNKLVLIEKA-LRFSQNLEH 263 >EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +2 Query: 530 GFKWKKIQNNKQILIERTDIRF-QRIEY 610 G W ++NNK +LIE+ +RF Q +E+ Sbjct: 237 GVTWISLRNNKLVLIEKA-LRFSQNLEH 263 >EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +2 Query: 530 GFKWKKIQNNKQILIERTDIRF-QRIEY 610 G W ++NNK +LIE+ +RF Q +E+ Sbjct: 237 GVTWISLRNNKLVLIEKA-LRFSQNLEH 263 >EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. Length = 500 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +2 Query: 530 GFKWKKIQNNKQILIERTDIRF-QRIEY 610 G W ++NNK +LIE+ +RF Q +E+ Sbjct: 237 GVTWISLRNNKLVLIEKA-LRFSQNLEH 263 >EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +2 Query: 530 GFKWKKIQNNKQILIERTDIRF-QRIEY 610 G W ++NNK +LIE+ +RF Q +E+ Sbjct: 237 GVTWISLRNNKLVLIEKA-LRFSQNLEH 263 >EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +2 Query: 530 GFKWKKIQNNKQILIERTDIRF-QRIEY 610 G W ++NNK +LIE+ +RF Q +E+ Sbjct: 237 GVTWISLRNNKLVLIEKA-LRFSQNLEH 263 >EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +2 Query: 530 GFKWKKIQNNKQILIERTDIRF-QRIEY 610 G W ++NNK +LIE+ +RF Q +E+ Sbjct: 237 GVTWISLRNNKLVLIEKA-LRFSQNLEH 263 >EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. Length = 448 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +2 Query: 530 GFKWKKIQNNKQILIERTDIRF-QRIEY 610 G W ++NNK +LIE+ +RF Q +E+ Sbjct: 237 GVTWISLRNNKLVLIEKA-LRFSQNLEH 263 >EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +2 Query: 530 GFKWKKIQNNKQILIERTDIRF-QRIEY 610 G W ++NNK +LIE+ +RF Q +E+ Sbjct: 237 GVTWISLRNNKLVLIEKA-LRFSQNLEH 263 >EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. Length = 421 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +2 Query: 530 GFKWKKIQNNKQILIERTDIRF-QRIEY 610 G W ++NNK +LIE+ +RF Q +E+ Sbjct: 237 GVTWISLRNNKLVLIEKA-LRFSQNLEH 263 >EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +2 Query: 530 GFKWKKIQNNKQILIERTDIRF-QRIEY 610 G W ++NNK +LIE+ +RF Q +E+ Sbjct: 237 GVTWISLRNNKLVLIEKA-LRFSQNLEH 263 >EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +2 Query: 530 GFKWKKIQNNKQILIERTDIRF-QRIEY 610 G W ++NNK +LIE+ +RF Q +E+ Sbjct: 237 GVTWISLRNNKLVLIEKA-LRFSQNLEH 263 >EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +2 Query: 530 GFKWKKIQNNKQILIERTDIRF-QRIEY 610 G W ++NNK +LIE+ +RF Q +E+ Sbjct: 237 GVTWISLRNNKLVLIEKA-LRFSQNLEH 263 >AY344814-1|AAR03842.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +2 Query: 530 GFKWKKIQNNKQILIERTDIRF-QRIEY 610 G W ++NNK +LIE+ +RF Q +E+ Sbjct: 162 GVTWISLRNNKLVLIEKA-LRFSQNLEH 188 >AY344813-1|AAR03841.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +2 Query: 530 GFKWKKIQNNKQILIERTDIRF-QRIEY 610 G W ++NNK +LIE+ +RF Q +E+ Sbjct: 162 GVTWISLRNNKLVLIEKA-LRFSQNLEH 188 >AY344812-1|AAR03840.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +2 Query: 530 GFKWKKIQNNKQILIERTDIRF-QRIEY 610 G W ++NNK +LIE+ +RF Q +E+ Sbjct: 162 GVTWISLRNNKLVLIEKA-LRFSQNLEH 188 >AY344811-1|AAR03839.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +2 Query: 530 GFKWKKIQNNKQILIERTDIRF-QRIEY 610 G W ++NNK +LIE+ +RF Q +E+ Sbjct: 162 GVTWISLRNNKLVLIEKA-LRFSQNLEH 188 >AY344810-1|AAR03838.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +2 Query: 530 GFKWKKIQNNKQILIERTDIRF-QRIEY 610 G W ++NNK +LIE+ +RF Q +E+ Sbjct: 162 GVTWISLRNNKLVLIEKA-LRFSQNLEH 188 >AY344809-1|AAR03837.1| 286|Anopheles gambiae LRR Toll protein. Length = 286 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +2 Query: 530 GFKWKKIQNNKQILIERTDIRF-QRIEY 610 G W ++NNK +LIE+ +RF Q +E+ Sbjct: 162 GVTWISLRNNKLVLIEKA-LRFSQNLEH 188 >AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CYP6S2 protein. Length = 504 Score = 24.2 bits (50), Expect = 3.5 Identities = 6/13 (46%), Positives = 11/13 (84%) Frame = -1 Query: 558 LFWIFFHLKPKFL 520 +FWI+FH + ++L Sbjct: 13 IFWIYFHFRQRYL 25 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.8 bits (49), Expect = 4.6 Identities = 13/39 (33%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = -3 Query: 289 YTLYSSDRTIRCHC--GSLLYFFYINHPVFRFSLHKGMN 179 Y +++R IR G + + Y + RFSLHK N Sbjct: 1918 YNYDNANRLIRKRTPDGGIWQYLYDKQGILRFSLHKEHN 1956 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 639,449 Number of Sequences: 2352 Number of extensions: 12831 Number of successful extensions: 115 Number of sequences better than 10.0: 44 Number of HSP's better than 10.0 without gapping: 114 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 115 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62305095 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -