BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11e15r (772 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27597| Best HMM Match : Cytochrom_B_N (HMM E-Value=0) 52 5e-07 SB_52148| Best HMM Match : EGF (HMM E-Value=0) 28 9.6 >SB_27597| Best HMM Match : Cytochrom_B_N (HMM E-Value=0) Length = 135 Score = 52.0 bits (119), Expect = 5e-07 Identities = 25/70 (35%), Positives = 39/70 (55%), Gaps = 3/70 (4%) Frame = -2 Query: 765 INWNYXFIILIATAFIG---YVLPXGQISFWGATVITNLLSAIPYLGTILVN*I*GGFAV 595 + W ++ + TA G Y LP QI +W ++T + AIP +G+ LV + G +V Sbjct: 44 LTWVTGVVLAVLTASFGVTGYSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASV 103 Query: 594 DNATLTRFYT 565 +TLTRFY+ Sbjct: 104 GQSTLTRFYS 113 >SB_52148| Best HMM Match : EGF (HMM E-Value=0) Length = 1055 Score = 27.9 bits (59), Expect = 9.6 Identities = 11/41 (26%), Positives = 19/41 (46%) Frame = -1 Query: 721 HRLCLTXRSNIFLGGNRNYKSIICNPLFRNYISKLNLRGIC 599 H +C+T R + F Y + C + + +S L G+C Sbjct: 931 HGICMTRRGDPFCVCTEGYTGLRCKVVINHCLSNPCLNGVC 971 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,963,499 Number of Sequences: 59808 Number of extensions: 218307 Number of successful extensions: 333 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 290 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 333 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2095976575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -