BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11e14r (642 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 23 2.8 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 23 2.8 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 22 4.9 DQ855504-1|ABH88191.1| 124|Tribolium castaneum chemosensory pro... 21 6.5 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 21 8.6 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 22.6 bits (46), Expect = 2.8 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +2 Query: 446 VAGDQFGCITIELVSTLVPPLKSVTEPR 529 V + G ++E V T+ PLK+ EP+ Sbjct: 308 VVNNSVGGESVETVLTVTAPLKAKIEPQ 335 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 22.6 bits (46), Expect = 2.8 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = +1 Query: 475 NRTGLNSGATAEECHGTKNDRYARALVGAIEPAVSSC 585 +R GL A +Y+ A G +P+VSSC Sbjct: 102 SRKGLFWSPAATAAATATEYKYSAAAPGPSDPSVSSC 138 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 21.8 bits (44), Expect = 4.9 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 330 SAVASGFGLTSSSGSITTNQVLSH 259 S V SG SSS S T+Q L H Sbjct: 55 SGVTSGSDFHSSSPSSDTSQDLQH 78 >DQ855504-1|ABH88191.1| 124|Tribolium castaneum chemosensory protein 18 protein. Length = 124 Score = 21.4 bits (43), Expect = 6.5 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = +2 Query: 131 RGPPESPRQVPTPPRPLVHKFEDCKTKGKANVQTKL 238 R PE + T P L C K KANV+ L Sbjct: 50 RCTPEGKKLKSTIPEALSTDCAKCNEKVKANVRKVL 85 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 21.0 bits (42), Expect = 8.6 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 Query: 424 DGHIITNGSRRPIRM 468 + HI+ GSR PI + Sbjct: 165 EAHIVPEGSRTPIEI 179 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,293 Number of Sequences: 336 Number of extensions: 3661 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16448590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -