BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11e14r (642 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g20060.1 68414.m02511 kinesin motor protein-related 33 0.16 At2g46180.1 68415.m05742 intracellular protein transport protein... 30 1.1 At2g28220.1 68415.m03426 aspartyl protease family protein contai... 30 1.1 At1g64170.1 68414.m07269 cation/hydrogen exchanger, putative (CH... 29 3.5 At1g06490.1 68414.m00688 glycosyl transferase family 48 protein ... 29 3.5 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 28 4.6 At3g03920.1 68416.m00407 Gar1 RNA-binding region family protein ... 28 4.6 At1g20160.1 68414.m02521 subtilase family protein similar to sub... 28 4.6 At4g33590.1 68417.m04772 hypothetical protein 28 6.1 At3g49640.1 68416.m05425 nitrogen regulation family protein simi... 28 6.1 At2g28390.1 68415.m03450 SAND family protein similar to Sand (GI... 28 6.1 At1g23790.1 68414.m03001 expressed protein 28 6.1 At5g38970.3 68418.m04714 cytochrome P450, putative similar to Cy... 27 8.0 At5g38970.1 68418.m04713 cytochrome P450, putative similar to Cy... 27 8.0 At3g23685.1 68416.m02978 F-box family protein contains TIGR01640... 27 8.0 At1g30490.1 68414.m03727 homeobox-leucine zipper transcription f... 27 8.0 At1g20150.1 68414.m02520 subtilase family protein similar to sub... 27 8.0 >At1g20060.1 68414.m02511 kinesin motor protein-related Length = 951 Score = 33.1 bits (72), Expect = 0.16 Identities = 21/60 (35%), Positives = 27/60 (45%) Frame = +2 Query: 77 EPNDVIPIKIGRLFLVTTRGPPESPRQVPTPPRPLVHKFEDCKTKGKANVQTKLFITSRF 256 E N IP I + T + + PTP V +DC G +NVQTK I+ RF Sbjct: 753 EENVGIPSTITHVEAEVTDFQRDQNQDDPTPSPEQVEVSQDCINSGLSNVQTKSAISRRF 812 >At2g46180.1 68415.m05742 intracellular protein transport protein USO1-related similar to Intracellular protein transport protein USO1 (Swiss-Prot:P25386) [Saccharomyces cerevisiae] Length = 725 Score = 30.3 bits (65), Expect = 1.1 Identities = 19/55 (34%), Positives = 27/55 (49%) Frame = +1 Query: 370 KSDRIDCIRQSNGTG*VNDGHIITNGSRRPIRMHYNRTGLNSGATAEECHGTKND 534 K R+D R SN +G N S+R NR +N+G A + +GT+ND Sbjct: 124 KESRLDLSRASNNNAIKGNGDHSPNRSQRSPTNWKNRNQMNNG-IASKPNGTEND 177 >At2g28220.1 68415.m03426 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 756 Score = 30.3 bits (65), Expect = 1.1 Identities = 16/63 (25%), Positives = 31/63 (49%), Gaps = 3/63 (4%) Frame = -1 Query: 366 SGQELQENFVGSSAVASGFGLTSSSGSITTNQVLSHVNLDVI---NNFVCTFAFPFVLQS 196 SGQ + G++A+ +G G ++ I + ++NLD + +N + T PF + Sbjct: 567 SGQGTSKINFGTNAIVAGDGTVAADMFIKKDNPFYYLNLDAVSVEDNLIATLGTPFHAED 626 Query: 195 SNL 187 N+ Sbjct: 627 GNI 629 Score = 27.5 bits (58), Expect = 8.0 Identities = 16/63 (25%), Positives = 31/63 (49%), Gaps = 3/63 (4%) Frame = -1 Query: 366 SGQELQENFVGSSAVASGFGLTSSSGSITTNQVLSHVNLDVI---NNFVCTFAFPFVLQS 196 SGQ + G++A+ +G G ++ I + ++NLD + +N + T PF + Sbjct: 228 SGQGTSKINFGTNAIVAGDGTVAADMFIKKDNPFYYLNLDAVSVEDNRIETLGTPFHAED 287 Query: 195 SNL 187 N+ Sbjct: 288 GNI 290 >At1g64170.1 68414.m07269 cation/hydrogen exchanger, putative (CHX16) monovalent cation:proton antiporter family 2 (CPA2) member, PMID:11500563 Length = 847 Score = 28.7 bits (61), Expect = 3.5 Identities = 18/66 (27%), Positives = 31/66 (46%) Frame = -1 Query: 414 PSPVTLSDTINTIALPSGQELQENFVGSSAVASGFGLTSSSGSITTNQVLSHVNLDVINN 235 PS + + + + LP + +EN SSAV F +S S++ V + L I+ Sbjct: 554 PSSIRMVQKVRSNGLPFWNKKREN---SSAVTVAFEASSKLSSVSVRSVTAISPLSTIHE 610 Query: 234 FVCTFA 217 +C+ A Sbjct: 611 DICSSA 616 >At1g06490.1 68414.m00688 glycosyl transferase family 48 protein contains Pfam profile: PF02364 1,3-beta-glucan synthase Length = 1933 Score = 28.7 bits (61), Expect = 3.5 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 4/48 (8%) Frame = -3 Query: 211 LRLAIFKLMHKWTRWCRHLPW*--LRWPSCCYKKQPS--YLDWYYIIW 80 +R + K + WC++L LR+P+ C K+Q S Y+ Y +IW Sbjct: 303 VRKLMEKYFKNYNSWCKYLRCDSYLRFPAGCDKQQLSLLYIGLYLLIW 350 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 28.3 bits (60), Expect = 4.6 Identities = 15/40 (37%), Positives = 17/40 (42%) Frame = +2 Query: 68 PRPEPNDVIPIKIGRLFLVTTRGPPESPRQVPTPPRPLVH 187 PRP P P T+ PP P P PP P+VH Sbjct: 687 PRPPPPPPPP---PMQHSTVTKVPPPPPPAPPAPPTPIVH 723 >At3g03920.1 68416.m00407 Gar1 RNA-binding region family protein contains Pfam profile PF04410: Gar1 protein RNA binding region Length = 202 Score = 28.3 bits (60), Expect = 4.6 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = -1 Query: 210 FVLQSSNLCTSGRGGVGTCRGDSGG 136 F+ Q T GRGG G RGDS G Sbjct: 143 FLPQPKGQSTGGRGGAGRGRGDSRG 167 >At1g20160.1 68414.m02521 subtilase family protein similar to subtilisin-type protease precursor GI:14150446 from [Glycine max] Length = 769 Score = 28.3 bits (60), Expect = 4.6 Identities = 35/133 (26%), Positives = 53/133 (39%), Gaps = 1/133 (0%) Frame = -1 Query: 468 HPNWSPATIRNDVAVIYLPSPVTLSDTINTIALPSGQELQENFVGSSAVASGFGLTSSSG 289 HP W P+ IR+ + T + T N G E ++ SG G SS+ Sbjct: 563 HPTWGPSAIRSAIM-------TTATQTNN----DKGLITTETGATATPYDSGAGELSSTA 611 Query: 288 SITTNQVLSHVNLDVINNFVCTFAFPFVLQSSNLCTSGRGGVGTCRGDSGGPLVVTRNNR 109 S+ V D + NF+C + + + + + TC DS L+ T N Sbjct: 612 SMQPGLVYETTETDYL-NFLCYYGYN--VTTIKAMSKAFPENFTCPADSNLDLISTINYP 668 Query: 108 PILIGITSF-GSG 73 IGI+ F G+G Sbjct: 669 S--IGISGFKGNG 679 >At4g33590.1 68417.m04772 hypothetical protein Length = 466 Score = 27.9 bits (59), Expect = 6.1 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -3 Query: 400 FV*YNQYDRSSKWTGITRKLCWILGSRFWLWSDQQLWI 287 FV YNQYD + W G+T + +I S Q W+ Sbjct: 164 FVSYNQYDYGNLWHGLTAVVPFIAWSLRNQCEKPQKWV 201 >At3g49640.1 68416.m05425 nitrogen regulation family protein similar to NITROGEN REGULATION PROTEIN NIFR3 (SP:Q08111) [Rhodobacter capsulatus]; contains Pfam domain PF01207: Dihydrouridine synthase (Dus) Length = 519 Score = 27.9 bits (59), Expect = 6.1 Identities = 13/45 (28%), Positives = 22/45 (48%) Frame = -1 Query: 354 LQENFVGSSAVASGFGLTSSSGSITTNQVLSHVNLDVINNFVCTF 220 +++N+V + L SSSG + T ++ + V FV TF Sbjct: 162 MKQNYVMQDKIVRSLSLKSSSGELETYSLMWSLRPGVFEFFVATF 206 >At2g28390.1 68415.m03450 SAND family protein similar to Sand (GI:3928166) [Takifugu rubripes]; contains Pfam PF03164: SAND family protein Length = 607 Score = 27.9 bits (59), Expect = 6.1 Identities = 17/43 (39%), Positives = 21/43 (48%) Frame = -1 Query: 504 GGTRVETSSIVMHPNWSPATIRNDVAVIYLPSPVTLSDTINTI 376 GGT SS+V +W+PAT + A LP P L TI Sbjct: 293 GGTDAVFSSLVHSFSWNPATFLH--AYTCLPLPYALRQATGTI 333 >At1g23790.1 68414.m03001 expressed protein Length = 518 Score = 27.9 bits (59), Expect = 6.1 Identities = 21/64 (32%), Positives = 29/64 (45%), Gaps = 4/64 (6%) Frame = -1 Query: 213 PFVLQSSNL----CTSGRGGVGTCRGDSGGPLVVTRNNRPILIGITSFGSGLGCQVNLPA 46 PFVL+ + L CT + +GT R + P V+TR P + + G L PA Sbjct: 145 PFVLKPAPLDFDQCTPAKHRLGTGRFMAASPNVMTRGRSPGGVRCSYGGGLLSKMAESPA 204 Query: 45 AYAR 34 A R Sbjct: 205 AMMR 208 >At5g38970.3 68418.m04714 cytochrome P450, putative similar to Cytochrome P450 85 (SP:Q43147) {Lycopersicon esculentum}; Length = 419 Score = 27.5 bits (58), Expect = 8.0 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = -3 Query: 589 IDSCSLLVRWHQPRHERNG 533 + CS L+RW+Q R+ +NG Sbjct: 15 VSLCSALLRWNQMRYTKNG 33 >At5g38970.1 68418.m04713 cytochrome P450, putative similar to Cytochrome P450 85 (SP:Q43147) {Lycopersicon esculentum}; Length = 465 Score = 27.5 bits (58), Expect = 8.0 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = -3 Query: 589 IDSCSLLVRWHQPRHERNG 533 + CS L+RW+Q R+ +NG Sbjct: 15 VSLCSALLRWNQMRYTKNG 33 >At3g23685.1 68416.m02978 F-box family protein contains TIGR01640: F-box protein interaction domain Length = 330 Score = 27.5 bits (58), Expect = 8.0 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -3 Query: 184 HKWTRWCRHLPW*LRWPSCCYKKQPSYLDWYY 89 H W R+ L + + SCCY K +D+YY Sbjct: 93 HGWDRFSYALGY-VNTDSCCYYKLLGLIDYYY 123 >At1g30490.1 68414.m03727 homeobox-leucine zipper transcription factor (HB-9) identical to HD-Zip protein GB:CAA71854 GI:2145358 from [Arabidopsis thaliana] Length = 841 Score = 27.5 bits (58), Expect = 8.0 Identities = 14/42 (33%), Positives = 24/42 (57%) Frame = -1 Query: 369 PSGQELQENFVGSSAVASGFGLTSSSGSITTNQVLSHVNLDV 244 P+G L +FV + ++SGF + G + ++ HV+LDV Sbjct: 307 PNGP-LSSSFVRAKMLSSGFLIRPCDGGGSIIHIVDHVDLDV 347 >At1g20150.1 68414.m02520 subtilase family protein similar to subtilisin-type protease precursor GI:14150446 from [Glycine max] Length = 780 Score = 27.5 bits (58), Expect = 8.0 Identities = 20/72 (27%), Positives = 37/72 (51%) Frame = -1 Query: 468 HPNWSPATIRNDVAVIYLPSPVTLSDTINTIALPSGQELQENFVGSSAVASGFGLTSSSG 289 +P+WSPA IR+ + + + V +++T + I +G++ G+ V FG SS G Sbjct: 567 YPSWSPAAIRSAI----MTTAVQMTNTGSHITTETGEKATPYDFGAGQVTI-FG-PSSPG 620 Query: 288 SITTNQVLSHVN 253 I + ++N Sbjct: 621 LIYETNHMDYLN 632 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,572,308 Number of Sequences: 28952 Number of extensions: 341952 Number of successful extensions: 1221 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 1118 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1216 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1324661040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -