BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11e14f (630 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 44 2e-06 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 23 2.4 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 23 2.4 AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropi... 23 2.4 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 21 9.9 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 21 9.9 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 43.6 bits (98), Expect = 2e-06 Identities = 34/138 (24%), Positives = 59/138 (42%), Gaps = 7/138 (5%) Frame = +1 Query: 172 TRIVGGSPATLGQFPYQGGLLITIVVNGQPRTGVCGASLVTTNRLLTAAHCWFD-GTNQX 348 +RIVGG+ + +FP G+ T +P +CGA++++ +LTAAHC D T + Sbjct: 159 SRIVGGTNTGINEFPMMAGIKRTY----EPGM-ICGATIISKRYVLTAAHCIIDENTTKL 213 Query: 349 XXXXXXXXXXXXFSGGTRV--ETSSIVMHPNWSPATIR----NDVAVIYLPSPVTLSDTI 510 V + +++HP + ND+A++ + D + Sbjct: 214 AIVVGEHDWSSKTETNATVLHSINKVIIHPKYDIIEKDDWQINDIALLKTEKDIKFGDKV 273 Query: 511 NTIALPSGQELQENFVGS 564 LP Q ++F GS Sbjct: 274 GPACLPF-QHFLDSFAGS 290 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 23.0 bits (47), Expect = 2.4 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +1 Query: 103 YLTKYGVPEAERIRKAEEAGLSN 171 YLTK+ VPE E+ GL++ Sbjct: 208 YLTKHNVPEQRLNYFTEDVGLNH 230 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 23.0 bits (47), Expect = 2.4 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +1 Query: 103 YLTKYGVPEAERIRKAEEAGLSN 171 YLTK+ VPE E+ GL++ Sbjct: 208 YLTKHNVPEQRLNYFTEDVGLNH 230 >AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropin releasing hormone-binding protein protein. Length = 332 Score = 23.0 bits (47), Expect = 2.4 Identities = 14/52 (26%), Positives = 23/52 (44%) Frame = +1 Query: 37 CLLLVAYGSAFTLPLHENPVYGYLTKYGVPEAERIRKAEEAGLSNTRIVGGS 192 C + Y S+ + V +L+ E IRK +E+ + I+GGS Sbjct: 217 CTYVALYPSSVQVIALGVGVSNFLSSTRTAETGTIRKCDESSPHDQVIIGGS 268 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 21.0 bits (42), Expect = 9.9 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +2 Query: 371 VP*HSSAVAPELRP 412 VP HS +P+LRP Sbjct: 217 VPKHSKTKSPKLRP 230 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 21.0 bits (42), Expect = 9.9 Identities = 6/17 (35%), Positives = 10/17 (58%) Frame = +3 Query: 342 PRHERNGRSWFRDTLQR 392 P H + WF+ ++QR Sbjct: 122 PNHSSHEHPWFKKSVQR 138 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,833 Number of Sequences: 438 Number of extensions: 3728 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18826962 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -