BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11e13r (440 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1827.06c |||aspartate semialdehyde dehydrogenase|Schizosacch... 31 0.10 SPBC1778.10c |ppk21|SPBC4C3.11|serine/threonine protein kinase P... 26 3.0 SPBC2G2.11 |||N-myristoyltransferase 1|Schizosaccharomyces pombe... 25 5.2 SPAC823.11 |||sphingosine-1-phosphate phosphatase |Schizosacchar... 25 6.8 SPCC16A11.04 |snx12||sorting nexin Snx12 |Schizosaccharomyces po... 24 9.0 SPBC11G11.07 ||SPBC18H10.01|karyopherin|Schizosaccharomyces pomb... 24 9.0 >SPCC1827.06c |||aspartate semialdehyde dehydrogenase|Schizosaccharomyces pombe|chr 3|||Manual Length = 357 Score = 30.7 bits (66), Expect = 0.10 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = +2 Query: 230 RFTKVKPTPPPVRRTLANCVDPRTRTALTRLPAGAVYL 343 +F K PTP VR LAN V + P A+Y+ Sbjct: 254 KFAKTSPTPDQVREVLANYVSEPQKLGCYSAPKQAIYV 291 >SPBC1778.10c |ppk21|SPBC4C3.11|serine/threonine protein kinase Ppk21|Schizosaccharomyces pombe|chr 2|||Manual Length = 550 Score = 25.8 bits (54), Expect = 3.0 Identities = 11/32 (34%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +3 Query: 69 RESLIKKMGRTNFLCKRKNKN-FVSLHVNVQN 161 R L+ +GR F+CK K++ F+ + VN+++ Sbjct: 454 RVMLLTDVGRCAFVCKGKHERLFIEMEVNLKD 485 >SPBC2G2.11 |||N-myristoyltransferase 1|Schizosaccharomyces pombe|chr 2|||Manual Length = 466 Score = 25.0 bits (52), Expect = 5.2 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +3 Query: 66 IRESLIKKMGRTNFLCKRK 122 +R+ +IKK NFLC K Sbjct: 171 VRDKIIKKCAEVNFLCIHK 189 >SPAC823.11 |||sphingosine-1-phosphate phosphatase |Schizosaccharomyces pombe|chr 1|||Manual Length = 411 Score = 24.6 bits (51), Expect = 6.8 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = -3 Query: 432 LTIDSEYQYKFPASFVVSRAAT 367 L+ D+EY+Y FP++ + AT Sbjct: 133 LSSDAEYEYGFPSTHTTNAMAT 154 >SPCC16A11.04 |snx12||sorting nexin Snx12 |Schizosaccharomyces pombe|chr 3|||Manual Length = 1010 Score = 24.2 bits (50), Expect = 9.0 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -3 Query: 426 IDSEYQYKFPASFVVSRAATTNSRA 352 ++SE Y+F A VVS +TNS A Sbjct: 520 VNSEIYYRFLAQDVVSDHKSTNSSA 544 >SPBC11G11.07 ||SPBC18H10.01|karyopherin|Schizosaccharomyces pombe|chr 2|||Manual Length = 955 Score = 24.2 bits (50), Expect = 9.0 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = +2 Query: 269 RTLANCVDPRTRTALTRL--PAGAVYLTLTAR 358 + +A C DP T AL RL AG ++ L AR Sbjct: 273 KLIAACDDPETFRALGRLFAEAGEAWVVLIAR 304 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,634,810 Number of Sequences: 5004 Number of extensions: 30388 Number of successful extensions: 84 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 83 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 84 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 160149590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -