BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11e12f (372 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 21 4.7 DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex det... 21 4.7 DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex det... 21 4.7 DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex det... 21 4.7 DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex det... 21 4.7 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 4.7 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 20 8.2 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 21.0 bits (42), Expect = 4.7 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -1 Query: 312 VLTSSSYLFLTNLCNVLRSWCY 247 V +SS LTN NV+ W Y Sbjct: 23 VRENSSGKNLTNTLNVIHKWKY 44 >DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 4.7 Identities = 12/42 (28%), Positives = 18/42 (42%) Frame = +3 Query: 165 KHCSFSPVVLREFNGRKHYIKVDCRRHDSTNSVRHYISLSKT 290 K C+ +L E RK Y + R +S + R Y +T Sbjct: 21 KLCNEEEKLLEERTSRKRYSRSREREQNSYKNEREYRKYRET 62 >DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 4.7 Identities = 12/42 (28%), Positives = 18/42 (42%) Frame = +3 Query: 165 KHCSFSPVVLREFNGRKHYIKVDCRRHDSTNSVRHYISLSKT 290 K C+ +L E RK Y + R +S + R Y +T Sbjct: 21 KLCNEEEKLLEERTSRKRYSRSREREQNSYKNEREYRKYRET 62 >DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 4.7 Identities = 12/42 (28%), Positives = 18/42 (42%) Frame = +3 Query: 165 KHCSFSPVVLREFNGRKHYIKVDCRRHDSTNSVRHYISLSKT 290 K C+ +L E RK Y + R +S + R Y +T Sbjct: 21 KLCNEEEKLLEERTSRKRYSRSREREQNSYKNEREYRKYRET 62 >DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 4.7 Identities = 12/42 (28%), Positives = 18/42 (42%) Frame = +3 Query: 165 KHCSFSPVVLREFNGRKHYIKVDCRRHDSTNSVRHYISLSKT 290 K C+ +L E RK Y + R +S + R Y +T Sbjct: 21 KLCNEEEKLLEERTSRKRYSRSREREQNSYKNEREYRKYRET 62 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.0 bits (42), Expect = 4.7 Identities = 5/9 (55%), Positives = 8/9 (88%) Frame = -1 Query: 255 WCYHGGGSQ 229 WCY+GG ++ Sbjct: 954 WCYYGGDAR 962 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 20.2 bits (40), Expect = 8.2 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +2 Query: 332 LNSEINMMRWE 364 LNSE + +RWE Sbjct: 83 LNSEAHRIRWE 93 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 112,314 Number of Sequences: 438 Number of extensions: 2634 Number of successful extensions: 25 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 8928360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -