BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11e09r (755 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q5C1N1 Cluster: SJCHGC02105 protein; n=1; Schistosoma j... 35 2.5 UniRef50_Q5ZWW2 Cluster: Putative uncharacterized protein; n=5; ... 34 4.4 UniRef50_UPI00015A63C6 Cluster: hypothetical protein LOC791177; ... 33 5.8 UniRef50_UPI00015B634E Cluster: PREDICTED: similar to conserved ... 33 7.6 UniRef50_UPI0000F1FF1D Cluster: PREDICTED: hypothetical protein;... 33 7.6 >UniRef50_Q5C1N1 Cluster: SJCHGC02105 protein; n=1; Schistosoma japonicum|Rep: SJCHGC02105 protein - Schistosoma japonicum (Blood fluke) Length = 127 Score = 34.7 bits (76), Expect = 2.5 Identities = 18/76 (23%), Positives = 35/76 (46%) Frame = +2 Query: 272 IIFLIVYLFS*CHSQIVSYTELTSECVQRVTILMKTIFQFRFEVCSVTVIGTVGVIASLA 451 I+ +++LFS + + S ++ C V + K +F VC +T + T + +L Sbjct: 9 ILLSMLFLFSVLSTNLFSPLSISCFCATSVCYIAKYFSEFNDSVCLITTVTTFVITVTLL 68 Query: 452 SEVIPCCVFAFFMIIW 499 S CV ++ I+ Sbjct: 69 SSTNNDCVVYIYIYIY 84 >UniRef50_Q5ZWW2 Cluster: Putative uncharacterized protein; n=5; Legionella pneumophila|Rep: Putative uncharacterized protein - Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 /ATCC 33152 / DSM 7513) Length = 252 Score = 33.9 bits (74), Expect = 4.4 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 2/57 (3%) Frame = -2 Query: 517 KVIRRLPDY-HKEG-KNAAWDYFRSKRRNYSYRSDDSYRTDLESKLEDGFHEYCHPL 353 ++I DY H G K+ WD+F ++ Y S S+ TD + K+ + YCHP+ Sbjct: 86 ELIASSADYSHLIGFKDRDWDFFYARPYLYPRGSGLSWHTDGKYKISGAYVYYCHPI 142 >UniRef50_UPI00015A63C6 Cluster: hypothetical protein LOC791177; n=1; Danio rerio|Rep: hypothetical protein LOC791177 - Danio rerio Length = 565 Score = 33.5 bits (73), Expect = 5.8 Identities = 18/51 (35%), Positives = 29/51 (56%) Frame = -2 Query: 685 KQKLVELLNRRYSELKEINSASNDMAVADSYREYCRYMDGKCKPSVLSILI 533 + + VEL++RR +EL + + A+ + R YC +D +C SV ILI Sbjct: 159 EMQYVELMSRRQAELDSLVAVGYRSALTEERRRYCFLVDRQC--SVTKILI 207 >UniRef50_UPI00015B634E Cluster: PREDICTED: similar to conserved hypothetical protein; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to conserved hypothetical protein - Nasonia vitripennis Length = 1714 Score = 33.1 bits (72), Expect = 7.6 Identities = 18/41 (43%), Positives = 26/41 (63%) Frame = +3 Query: 12 SQLQLFVFFYID*YIKDRRASVINIKSKNIVICFLFLFKNV 134 S+++L V + ID IK+ S IN+ SKNIV F +F+ V Sbjct: 61 SEIKLPVLYLIDSIIKNVNGSYINLFSKNIVQTFCNVFEKV 101 >UniRef50_UPI0000F1FF1D Cluster: PREDICTED: hypothetical protein; n=1; Danio rerio|Rep: PREDICTED: hypothetical protein - Danio rerio Length = 551 Score = 33.1 bits (72), Expect = 7.6 Identities = 18/47 (38%), Positives = 27/47 (57%) Frame = -2 Query: 673 VELLNRRYSELKEINSASNDMAVADSYREYCRYMDGKCKPSVLSILI 533 VEL++RR +EL + + A+ + R YC +D +C SV ILI Sbjct: 108 VELMSRRQAELDSLVAVGYRSALTEERRRYCFLVDRQC--SVTKILI 152 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 647,920,894 Number of Sequences: 1657284 Number of extensions: 12984019 Number of successful extensions: 31364 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 30291 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31354 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 62558016040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -