BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11e09r (755 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetyla... 24 1.5 EU019713-1|ABU25225.1| 528|Tribolium castaneum chitin deacetyla... 23 2.0 EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 23 3.5 AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase prot... 22 6.1 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 21 8.0 >EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetylase 2A protein. Length = 535 Score = 23.8 bits (49), Expect = 1.5 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +3 Query: 504 RLITLTSQGTINIDRTD 554 ++ITLT G +NID D Sbjct: 192 QMITLTFNGAVNIDNID 208 >EU019713-1|ABU25225.1| 528|Tribolium castaneum chitin deacetylase 2B protein. Length = 528 Score = 23.4 bits (48), Expect = 2.0 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +3 Query: 504 RLITLTSQGTINIDRTD 554 ++ITLT G +N+D D Sbjct: 185 QMITLTFNGAVNVDNID 201 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 22.6 bits (46), Expect = 3.5 Identities = 6/17 (35%), Positives = 10/17 (58%) Frame = +2 Query: 467 CCVFAFFMIIWQTSDHL 517 CC+ F + WQ + +L Sbjct: 16 CCILFFIYLYWQQTSNL 32 >AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase protein. Length = 590 Score = 21.8 bits (44), Expect = 6.1 Identities = 13/55 (23%), Positives = 27/55 (49%) Frame = -2 Query: 652 YSELKEINSASNDMAVADSYREYCRYMDGKCKPSVLSILIVPWLVKVIRRLPDYH 488 + L + A A A+ +++C+ +D + S++ I+P VK + P+ H Sbjct: 289 FQNLLKDTEAEVRAAAANKVKDFCQNLDKAHQESIIMNNILP-CVKELVADPNQH 342 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 21.4 bits (43), Expect = 8.0 Identities = 8/33 (24%), Positives = 17/33 (51%) Frame = -2 Query: 469 AWDYFRSKRRNYSYRSDDSYRTDLESKLEDGFH 371 AWD F + ++ ++Y + S ++ + FH Sbjct: 547 AWDKFTNMQQQFAYIDESSNSSNYFANKTYDFH 579 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,970 Number of Sequences: 336 Number of extensions: 3568 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20234955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -