BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11e09r (755 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44957| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.33 SB_50210| Best HMM Match : I-set (HMM E-Value=0.11) 31 0.76 SB_10643| Best HMM Match : ShTK (HMM E-Value=2.9e-23) 31 0.76 SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.1 >SB_44957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1336 Score = 32.7 bits (71), Expect = 0.33 Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 3/54 (5%) Frame = +2 Query: 116 VFIQKRSIIKKNTIR---FPNKYANTSQISRIFFYDGQTSITTVLVVKKSVGCF 268 VF+ + ++ NT R F N +T I R FF GQ++ T LVV+ + G F Sbjct: 506 VFLSRAVYVQTNTCRQSTFQNNTGSTRHI-RCFFSPGQSTSRTTLVVRHTSGVF 558 >SB_50210| Best HMM Match : I-set (HMM E-Value=0.11) Length = 348 Score = 31.5 bits (68), Expect = 0.76 Identities = 21/95 (22%), Positives = 48/95 (50%), Gaps = 4/95 (4%) Frame = +2 Query: 140 IKKNTIRFPNKYANTSQISRIFFYDGQTSITTVLVVK-KSVGCFRIIFLIVYLFS*CHSQ 316 ++ ++++ N SQ+ R+ + Q+SI +V + K C R + ++ +++ C S Sbjct: 29 VRAMSVKYCECTRNVSQVLRV-YAQCQSSIASVPAMSVKYCECARNVSQVLQVYAQCQSS 87 Query: 317 IVSYTELT---SECVQRVTILMKTIFQFRFEVCSV 412 I S ++ EC + V+ +++ Q + + SV Sbjct: 88 IASVPAMSVKYCECTRNVSQVLRVCAQCQSSIASV 122 >SB_10643| Best HMM Match : ShTK (HMM E-Value=2.9e-23) Length = 2123 Score = 31.5 bits (68), Expect = 0.76 Identities = 21/95 (22%), Positives = 48/95 (50%), Gaps = 4/95 (4%) Frame = +2 Query: 140 IKKNTIRFPNKYANTSQISRIFFYDGQTSITTVLVVK-KSVGCFRIIFLIVYLFS*CHSQ 316 ++ ++++ N SQ+ R+ + Q+SI +V + K C R + ++ +++ C S Sbjct: 1575 VRAMSVKYCECTRNVSQVLRV-YAQCQSSIASVPAMSVKYCECARNVSQVLQVYAQCQSS 1633 Query: 317 IVSYTELT---SECVQRVTILMKTIFQFRFEVCSV 412 I S ++ EC + V+ +++ Q + + SV Sbjct: 1634 IASVPAMSVKYCECTRNVSQVLRVCAQCQSSIASV 1668 >SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 28.3 bits (60), Expect = 7.1 Identities = 17/73 (23%), Positives = 32/73 (43%) Frame = -2 Query: 535 IVPWLVKVIRRLPDYHKEGKNAAWDYFRSKRRNYSYRSDDSYRTDLESKLEDGFHEYCHP 356 I W ++ R + K+ K+ Y R + + Y+++ DD R + + H Sbjct: 564 IFDWCMRTWHRFSELSKQ-KDVTGVYMRQRIKLYTHKIDDDLRVKEHMQAHQHLPGFRHS 622 Query: 355 LNALTREFGI*DD 317 L +T ++GI D Sbjct: 623 LQIIT-DYGINGD 634 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,246,427 Number of Sequences: 59808 Number of extensions: 415443 Number of successful extensions: 1011 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 917 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1011 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2058295707 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -