BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fmgV11e05r (729 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. 25 3.2 AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 24 4.2 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 24 5.5 AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 23 7.3 >AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. Length = 786 Score = 24.6 bits (51), Expect = 3.2 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -3 Query: 433 KQRTTTGNKRCSIR*SYSHRRIWCQQKRLGHCY 335 K R+ T RC +R + H+R W + CY Sbjct: 446 KNRSLTEMGRCMLRDAGMHKRFWAEAVNTA-CY 477 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 24.2 bits (50), Expect = 4.2 Identities = 10/37 (27%), Positives = 19/37 (51%) Frame = -1 Query: 576 LKNLKLPLNKVHIVGFNLGAHVAGVTGRNLEGKVARI 466 L+ +KL + K H ++ + + R EGK+ R+ Sbjct: 972 LEEMKLAIEKAHEGSSSIKKEIVALQKREAEGKMKRL 1008 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.8 bits (49), Expect = 5.5 Identities = 23/80 (28%), Positives = 35/80 (43%), Gaps = 3/80 (3%) Frame = -1 Query: 690 LRSGNYNVIVVDWSS-FSLSTYSTAVMAVTG--VGSSIATFLKNLKLPLNKVHIVGFNLG 520 L +GN V ++D F++ + V A G +G+S A N K IVG +G Sbjct: 2670 LYAGNSPVSLIDPDGQFAILLIVSIVTAAVGAYLGASAANKSWNPAKWEVKKAIVGATMG 2729 Query: 519 AHVAGVTGRNLEGKVARITG 460 A V G + G + + G Sbjct: 2730 AIVGGFAPVGIAGSITFLAG 2749 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 23.4 bits (48), Expect = 7.3 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 696 RVLRSGNYNVIVVDWSS 646 RVL +G++N + +DW S Sbjct: 116 RVLLAGDFNAMHLDWGS 132 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 760,014 Number of Sequences: 2352 Number of extensions: 15529 Number of successful extensions: 33 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74428737 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -